Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1260 [new locus tag: NWMN_RS07110 ]
- pan locus tag?: SAUPAN003727000
- symbol: mscL
- pan gene symbol?: mscL
- synonym:
- product: large-conductance mechanosensitive channel
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1260 [new locus tag: NWMN_RS07110 ]
- symbol: mscL
- product: large-conductance mechanosensitive channel
- replicon: chromosome
- strand: -
- coordinates: 1384012..1384374
- length: 363
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330750 NCBI
- RefSeq: YP_001332294 NCBI
- BioCyc:
- MicrobesOnline: 3706812 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTTAAAAGAATTCAAAGAGTTCGCCTTAAAAGGTAACGTCTTAGATTTAGCAATTGCT
GTTGTGATGGGTGCAGCTTTCAACAAGATTATATCTTCATTAGTAGAAAATATCATTATG
CCATTAATTGGTAAAATTTTCGGATCAGTTGATTTTGCTAAAGAATGGTCATTCTGGGGT
ATTAAATACGGTTTATTTATCCAATCTGTTATCGACTTTATTATCATCGCGTTTGCTTTA
TTCATCTTTGTTAAGATTGCAAATACATTAATGAAGAAAGAAGAAGCCGAAGAAGAAGCA
GTTGTGGAAGAAAATGTTGTGTTATTAACTGAAATCAGAGATTTATTACGTGAGAAAAAA
TAA60
120
180
240
300
360
363
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1260 [new locus tag: NWMN_RS07110 ]
- symbol: MscL
- description: large-conductance mechanosensitive channel
- length: 120
- theoretical pI: 4.73922
- theoretical MW: 13616.2
- GRAVY: 0.641667
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Adaptations to atypical conditions large conductance mechanosensitive channel protein (TIGR00220; HMM-score: 126.6)
- TheSEED :
- Large-conductance mechanosensitive channel
Potassium metabolism Potassium metabolism - no subcategory Glutathione-regulated potassium-efflux system and associated functions Large-conductance mechanosensitive channeland 1 more - PFAM: no clan defined MscL; Large-conductance mechanosensitive channel, MscL (PF01741; HMM-score: 135.8)and 1 moreMim2; Mitochondrial import 2 (PF19117; HMM-score: 13.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0003
- Cytoplasmic Membrane Score: 0.9593
- Cell wall & surface Score: 0
- Extracellular Score: 0.0403
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.019989
- TAT(Tat/SPI): 0.002238
- LIPO(Sec/SPII): 0.012643
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIFGSVDFAKEWSFWGIKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKEEAEEEAVVEENVVLLTEIRDLLREKK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]