Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1848 [new locus tag: NWMN_RS10615 ]
- pan locus tag?: SAUPAN004940000
- symbol: NWMN_1848
- pan gene symbol?: scpB
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1848 [new locus tag: NWMN_RS10615 ]
- symbol: NWMN_1848
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2059840..2060166
- length: 327
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5332510 NCBI
- RefSeq: YP_001332882 NCBI
- BioCyc:
- MicrobesOnline: 3707436 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGAACAAATTGAATTATTTAGTATTGATAAATTCAAATGTAATTCAGAGGCTAAGTAT
TATCTTAATATTATTGAGGGAGAATGGCATCCTCAAGATTTAAATGATAGTCCTTTAAAA
TTTATTCTCAGTACCTCAGACGATTCTGATTACATTTGCAAATATATAAATACAGAACAC
AAACAACTCACATTATATAATAAAAATAATAGCTCAATTGTTATTGAAATATTTATACCA
AATGATAATAAAATACTACTAACAATTATGAACACAGAAGCTTTGGGAACTTCTCCTAGA
ATGACTTTCATTAAGCATAAGTCATAA60
120
180
240
300
327
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1848 [new locus tag: NWMN_RS10615 ]
- symbol: NWMN_1848
- description: hypothetical protein
- length: 108
- theoretical pI: 5.12117
- theoretical MW: 12607.3
- GRAVY: -0.417593
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01108472: hypothetical protein
- PFAM: bBprotInhib (CL0354) Staphostatin_A; Staphostatin A (PF09022; HMM-score: 194.6)and 1 moreStaphostatin_B; Staphostatin B (PF09023; HMM-score: 14.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.1255
- Cytoplasmic Membrane Score: 0.0027
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.8715
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011483
- TAT(Tat/SPI): 0.000379
- LIPO(Sec/SPII): 0.003459
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEQIELFSIDKFKCNSEAKYYLNIIEGEWHPQDLNDSPLKFILSTSDDSDYICKYINTEHKQLTLYNKNNSSIVIEIFIPNDNKILLTIMNTEALGTSPRMTFIKHKS
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]