From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2289 [new locus tag: NWMN_RS13170 ]
  • pan locus tag?: SAUPAN005918000
  • symbol: NWMN_2289
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_2289 [new locus tag: NWMN_RS13170 ]
  • symbol: NWMN_2289
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2514839..2515477
  • length: 639
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGTATAAAATCAATATTATTAGATCAGATTCCGTCTATAATAATATACTCAAGGCACCA
    ATAAACGACCGTGATTCAATTTTCACTAAAGAAATATTAGTACCTTTTAAAAAGAAATTT
    GAGGTACAACATATGCCTATTTATAATGATGACAAACAGACAATGAGTGCGATTCAATTT
    TTAGATGCCTTTCAAATTTCTCCCAAAGATTTACGCATGTCTGACCAAATGTCAATACAA
    TACCTGAATAATGATTTCTGGAGTAATTGCGAAAAATATTTAAAAGTTGCTATAGATCAA
    TTTTCAAATTATAGTATCTCATCTCAAGTTTCTAACTATCATTTCACAGTATTACTTGGA
    GATCGCCAAAAACCACTTATGTATCTAAATAAAAATCGCGGTGGTGATGGTGGCATACCA
    GGTTATATTATGATTTATTTAGTGCCGAGTACAAGTACAATTAATTCTATGAAAAGCTTA
    ATTGCACATGAAGTAAATCATAATATGCGCTATCAATATATTGATTGGGATGGCGGAAGT
    TTGATTGAATTGATTATTGCAGAAGGATTAGCTGAAAACTATGTAGAATCATTGTATGGT
    AAAGCGCATATTGGACCGTGGGTAACAAATACTAATTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    639

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_2289 [new locus tag: NWMN_RS13170 ]
  • symbol: NWMN_2289
  • description: hypothetical protein
  • length: 212
  • theoretical pI: 6.68031
  • theoretical MW: 24458.8
  • GRAVY: -0.321226

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:  
    FIG01108860: hypothetical protein
  • PFAM:
    Peptidase_MA (CL0126) DUF2268; Predicted Zn-dependent protease (DUF2268) (PF10026; HMM-score: 92.9)
    and 1 more
    no clan defined DUF3631; Protein of unknown function (DUF3631) (PF12307; HMM-score: 12.4)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00175
    • TAT(Tat/SPI): 0.000166
    • LIPO(Sec/SPII): 0.000218
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MYKINIIRSDSVYNNILKAPINDRDSIFTKEILVPFKKKFEVQHMPIYNDDKQTMSAIQFLDAFQISPKDLRMSDQMSIQYLNNDFWSNCEKYLKVAIDQFSNYSISSQVSNYHFTVLLGDRQKPLMYLNKNRGGDGGIPGYIMIYLVPSTSTINSMKSLIAHEVNHNMRYQYIDWDGGSLIELIIAEGLAENYVESLYGKAHIGPWVTNTN

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • NWMN_2289 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]