From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2366 [new locus tag: NWMN_RS13635 ]
  • pan locus tag?: SAUPAN006029000
  • symbol: NWMN_2366
  • pan gene symbol?: cntL
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_2366 [new locus tag: NWMN_RS13635 ]
  • symbol: NWMN_2366
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2603723..2604541
  • length: 819
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAATAACTTTAATAATGAAATCAAATTGATATTACAACAATATTTAGAAAAGTTTGAA
    GCGCATTACGAGCGTGTATTACAAGACGATCAATATATCGAAGCATTAGAAACATTGATG
    GATGACTATAGTGAATTTATTTTAAATCCTATTTATGAACAACAATTTAATGCTTGGCGT
    GACGTTGAAGAAAAAGCACAATTAATAAAATCACTGCAATATATTACAGCGCAGTGTGTT
    AAACAAGTGGAAGTCATTAGAGCGAGACGTCTATTAGACGGACAGGCGTCTACCACAGGT
    TACTTTGACAATATAGAACATTGTATTGATGAAGAGTTTGGACAATGTAGTATAGCTAGC
    AATGACAAATTATTGTTAGTTGGTTCAGGTGCATATCCAATGACGTTAATTCAAGTAGCA
    AAAGAAACAGGTGCTTCAGTTATCGGTATTGATATTGATCCACAAGCCGTTGACCTAGGG
    CGCAGAATCGTTAACGTCTTAGCACCAAATGAAGATATAACAATTACGGATCAAAAGGTA
    TCTGAACTTAAAGATATCAAAGATGTGACGCATATCATATTCAGCTCGACAATTCCTTTA
    AAGTACAGCATTTTAGAAGAATTATATGATTTAACAAATGAAAATGTCGTAGTTGCAATG
    CGCTTTGGTGATGGCATCAAAGCAATATTTAATTATCCGTCACAAGAAACAGCGGAAGAT
    AAGTGGCAATGTGTGAATAAACATATGAGACCACAGCAAATTTTTGATATAGCACTTTAT
    AAAAAAGCAGCTATAAAGGTAGGTATTACGGATGTCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    819

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_2366 [new locus tag: NWMN_RS13635 ]
  • symbol: NWMN_2366
  • description: hypothetical protein
  • length: 272
  • theoretical pI: 4.37556
  • theoretical MW: 31096.2
  • GRAVY: -0.212868

Function[edit | edit source]

  • TIGRFAM:
    6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase (TIGR03201; EC 1.1.1.-; HMM-score: 20.7)
    and 4 more
    T-complex protein 1, theta subunit (TIGR02346; HMM-score: 14.8)
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein L11 methyltransferase (TIGR00406; EC 2.1.1.-; HMM-score: 13)
    Unknown function Enzymes of unknown specificity putative methylase (TIGR00537; HMM-score: 13)
    2-aminoethylphosphonate aminotransferase (TIGR03301; EC 2.6.1.-; HMM-score: 13)
  • TheSEED:  
    FIG016157: Similar to nicotianamine synthase
  • PFAM:
    NADP_Rossmann (CL0063) Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 17.8)
    NAS; Nicotianamine synthase protein (PF03059; HMM-score: 17.6)
    Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 17.3)
    ADH_zinc_N; Zinc-binding dehydrogenase (PF00107; HMM-score: 16.1)
    and 1 more
    no clan defined Noelin-1; Neurogenesis glycoprotein (PF12308; HMM-score: 12.5)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001139
    • TAT(Tat/SPI): 0.000084
    • LIPO(Sec/SPII): 0.000189
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNNFNNEIKLILQQYLEKFEAHYERVLQDDQYIEALETLMDDYSEFILNPIYEQQFNAWRDVEEKAQLIKSLQYITAQCVKQVEVIRARRLLDGQASTTGYFDNIEHCIDEEFGQCSIASNDKLLLVGSGAYPMTLIQVAKETGASVIGIDIDPQAVDLGRRIVNVLAPNEDITITDQKVSELKDIKDVTHIIFSSTIPLKYSILEELYDLTNENVVVAMRFGDGIKAIFNYPSQETAEDKWQCVNKHMRPQQIFDIALYKKAAIKVGITDV

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]