From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2440 [new locus tag: NWMN_RS14020 ]
  • pan locus tag?: SAUPAN006198000
  • symbol: cidA
  • pan gene symbol?: cidA
  • synonym:
  • product: holin-like protein CidA

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_2440 [new locus tag: NWMN_RS14020 ]
  • symbol: cidA
  • product: holin-like protein CidA
  • replicon: chromosome
  • strand: -
  • coordinates: 2683152..2683547
  • length: 396
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGCACAAAGTCCAATTAATAATCAAACTACTACTACAACTAGGAATCATCATTGTGATT
    ACTTATATTGGCACAGAAATTCAAAAGATTTTTCATCTTCCCTTAGCCGGCAGTATTGTT
    GGTCTATTTTTATTTTATTTACTATTACAATTTAAGATTGTACCGCTAACTTGGGTAGAA
    GACGGTGCAAACTTTTTATTAAAGACGATGGTCTTTTTCTTCATACCGTCAGTTGTAGGT
    ATTATGGATGTTGCTTCCGAAATTACGCTAAATTATATACTCTTTTTCGCAGTCATTATC
    ATAGGAACATGTATCGTTGCATTATCTTCAGGTTATATTGCTGAAAAAATGTCTGTTAAA
    CATAAACATCGTAAAGGTGTAGACGCTTATGAATGA
    60
    120
    180
    240
    300
    360
    396


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_2440 [new locus tag: NWMN_RS14020 ]
  • symbol: CidA
  • description: holin-like protein CidA
  • length: 131
  • theoretical pI: 9.01426
  • theoretical MW: 14729.8
  • GRAVY: 1.04962

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Holin-like protein CidA
    Regulation and Cell signaling Programmed Cell Death and Toxin-antitoxin Systems Murein hydrolase regulation and cell death  Holin-like protein CidA
  • PFAM:
    no clan defined LrgA; LrgA family (PF03788; HMM-score: 86.6)
    and 1 more
    Frag1-like (CL0412) Frag1; Frag1/DRAM/Sfk1 family (PF10277; HMM-score: 10)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.9997
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0002
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004866
    • TAT(Tat/SPI): 0.000114
    • LIPO(Sec/SPII): 0.016401
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVEDGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVKHKHRKGVDAYE

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: SigB (activation) regulon
    SigB(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [1]   other strains

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J Bacteriol: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]