From AureoWiki
Jump to navigation Jump to search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS00260 [old locus tag: NWMN_0044 ]
  • pan locus tag?: SAUPAN000862000
  • symbol: NWMN_RS00260
  • pan gene symbol?:
  • synonym:
  • product: tandem-type lipoprotein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS00260 [old locus tag: NWMN_0044 ]
  • symbol: NWMN_RS00260
  • product: tandem-type lipoprotein
  • replicon: chromosome
  • strand: +
  • coordinates: 57117..57887
  • length: 771
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (57117..57887) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGATGAAACGATTAAACAAATTAGTGTTAGGCATTATTTTTCTGTTTTTAGTCATTAGT
    ATCACTGCTGGTTGTGGCATAGGTAAAGAAGCGAAAATAAAGAAAAGTTTTGAGAAGACA
    TTGAGTATGTATCCGATTAAAAATCTAGAGGATTTATACGATAAAGAAGGTTATCGTGAT
    GACGAATTTGATAAAAATGATAAAGGTACATGGATTATTGGTTCTGAAATGGCAACTCAA
    AATAAGGGGGAAGCTCTGAAAGTTAAAGGTATGGTCTTGTATATGAATAGAAATACCAAA
    ACAACAAAAGGATATTATTATGTAAATGCAATAAAGAATGATAAAGACGGAAGACCCCAA
    GAGAATGAAAAAAGGTACCCAGTTAAAATGGTCGATAATAAAATCATTCCAACAAAAGAA
    ATTAAAGATAAAAACATAAAAAAAGAAATCGAAAACTTTAAGTTCTTTGTTCAATATGGA
    AACTTTAAAGATTTGTCGAAGTATAAAGACGGAGATATTTCATATAATCCAGAGGTGCCG
    AGTTATTCGGCTAAATATCAATTAACTAATGATGATTACAATGTAAAGCAATTACGTAAA
    AGATATGACATACCAACAAATAAAGCACCGAAGTTGTTGTTGAAGGGTACAGGGAATTTA
    AAAGGTTCATCAGTTGGATATAAAGACATTGAATTTACGTTTGTAGAGAAAAAAGAAGAG
    AACATTTACTTTAGTGATGGGTTAATTTTTAAACCAAGTGAGGATAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    771

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS00260 [old locus tag: NWMN_0044 ]
  • symbol: NWMN_RS00260
  • description: tandem-type lipoprotein
  • length: 256
  • theoretical pI: 9.83455
  • theoretical MW: 29708
  • GRAVY: -0.783594

Function[edit | edit source]

  • TIGRFAM:
    Staphylococcus tandem lipoproteins (TIGR01742; HMM-score: 391.4)
  • TheSEED:
  • PFAM:
    LolA_LolB (CL0048) DUF576; Csa1 family (PF04507; HMM-score: 427.2)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • LocateP:
  • SignalP: Signal peptide LIPO(Sec/SPII) length 24 aa
    • SP(Sec/SPI): 0.00109
    • TAT(Tat/SPI): 0.000086
    • LIPO(Sec/SPII): 0.998582
    • Cleavage Site: CS pos: 24-25. TAG-CG. Pr: 0.9992
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI: 446900525 NCBI
  • RefSeq: WP_000977781 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MMKRLNKLVLGIIFLFLVISITAGCGIGKEAKIKKSFEKTLSMYPIKNLEDLYDKEGYRDDEFDKNDKGTWIIGSEMATQNKGEALKVKGMVLYMNRNTKTTKGYYYVNAIKNDKDGRPQENEKRYPVKMVDNKIIPTKEIKDKNIKKEIENFKFFVQYGNFKDLSKYKDGDISYNPEVPSYSAKYQLTNDDYNVKQLRKRYDIPTNKAPKLLLKGTGNLKGSSVGYKDIEFTFVEKKEENIYFSDGLIFKPSEDK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]