From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS01105 [old locus tag: NWMN_0198 ]
  • pan locus tag?: SAUPAN001143000
  • symbol: NWMN_RS01105
  • pan gene symbol?: bglR
  • synonym:
  • product: GntR family transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS01105 [old locus tag: NWMN_0198 ]
  • symbol: NWMN_RS01105
  • product: GntR family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 255343..256047
  • length: 705
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (255343..256047) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    TTGTTAAAGTATGAACATATTGCTAAGCAACTTAATGCGTTTATACATCAATCTAATTTC
    AAACCCGGTGATAAATTGCCAAGCGTGACGCAATTAAAAGAACGTTATCAAGTAAGTAAG
    AGTACTATCATTAAAGCATTAGGCTTATTGGAACAAGATGGTTTGATCTATCAAGCACAA
    GGCAGTGGTATTTATGTGAGAAATATTGCTGATGCCAATCGTATCAACGTCTTTAAGACT
    AATGGTTTCTCTAAAAGTTTAGGTGAACACCGAATGACAAGTAAGGTACTTGTTTTTAAG
    GAGATTGCAACGCCACCTAAATCTGTACAAGATGAGCTCCAATTAAATGCAGATGATACC
    GTCTACTATTTAGAGCGATTAAGATTCGTGGACGATGATGTTTTATGTATCGAATATTCT
    TATTATCATAAAGAAATCGTGAAATATTTAAATGATGATATTGCTAAGGGCTCTATCTTC
    GACTATTTAGAATCAAACATGAAACTTCGTATTGGTTTTTCAGATATTTTCTTTAATGTA
    GATCAACTCACTTCAAGTGAAGCTTCATTACTACAATTGTCTACAGGTGAACCATGTTTA
    CGTTACCACCAGACTTTTTATACAATGACTGGCAAACCCTTTGATTCATCTGACATCGTA
    TTTCATTATCGTCATGCACAGTTTTATATTCCTAGTAAAAAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    705

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS01105 [old locus tag: NWMN_0198 ]
  • symbol: NWMN_RS01105
  • description: GntR family transcriptional regulator
  • length: 234
  • theoretical pI: 7.67897
  • theoretical MW: 27013.6
  • GRAVY: -0.359829

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions trehalose operon repressor (TIGR02404; HMM-score: 112.2)
    Signal transduction Regulatory functions DNA interactions phosphonate utilization transcriptional regulator PhnR (TIGR03337; HMM-score: 90.1)
    and 10 more
    Metabolism Transport and binding proteins Anions phosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 77.2)
    Signal transduction Regulatory functions DNA interactions phosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 77.2)
    Metabolism Energy metabolism Amino acids and amines histidine utilization repressor (TIGR02018; HMM-score: 66.7)
    Signal transduction Regulatory functions DNA interactions histidine utilization repressor (TIGR02018; HMM-score: 66.7)
    phosphonate utilization associated transcriptional regulator (TIGR03338; HMM-score: 27.8)
    Metabolism Fatty acid and phospholipid metabolism Biosynthesis fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 17.4)
    Metabolism Fatty acid and phospholipid metabolism Degradation fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 17.4)
    Signal transduction Regulatory functions DNA interactions fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 17.4)
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 12.9)
    Unknown function General Rrf2 family protein (TIGR00738; HMM-score: 12.1)
  • TheSEED:
  • PFAM:
    UTRA (CL0122) UTRA; UTRA domain (PF07702; HMM-score: 91.7)
    and 11 more
    HTH (CL0123) GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 61.1)
    HTH_41; Helix-turn-helix domain (PF14502; HMM-score: 22.8)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 21.7)
    Rrf2; Transcriptional regulator (PF02082; HMM-score: 16.8)
    HTH_11; HTH domain (PF08279; HMM-score: 16)
    Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 15.4)
    MarR; MarR family (PF01047; HMM-score: 15.3)
    MarR_2; MarR family (PF12802; HMM-score: 15.2)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 14.2)
    HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 13.1)
    RPA_C; Replication protein A C terminal (PF08784; HMM-score: 12.9)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00433
    • TAT(Tat/SPI): 0.000361
    • LIPO(Sec/SPII): 0.000474
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446845073 NCBI
  • RefSeq: WP_000922329 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MLKYEHIAKQLNAFIHQSNFKPGDKLPSVTQLKERYQVSKSTIIKALGLLEQDGLIYQAQGSGIYVRNIADANRINVFKTNGFSKSLGEHRMTSKVLVFKEIATPPKSVQDELQLNADDTVYYLERLRFVDDDVLCIEYSYYHKEIVKYLNDDIAKGSIFDYLESNMKLRIGFSDIFFNVDQLTSSEASLLQLSTGEPCLRYHQTFYTMTGKPFDSSDIVFHYRHAQFYIPSKK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]