Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS01855 [old locus tag: NWMN_0326 ]
- pan locus tag?: SAUPAN001868000
- symbol: NWMN_RS01855
- pan gene symbol?: mepR
- synonym:
- product: multidrug efflux MATE transporter transcriptional repressor MepR
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS01855 [old locus tag: NWMN_0326 ]
- symbol: NWMN_RS01855
- product: multidrug efflux MATE transporter transcriptional repressor MepR
- replicon: chromosome
- strand: +
- coordinates: 376522..376941
- length: 420
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGGAATTCACTTATTCGTATTTATTTAGAATGATTAGTCATGAGATGAAACAAAAGGCT
GATCAAAAGTTAGAGCAATTTGATATTACAAATGAGCAAGGTCATACGTTAGGTTATCTT
TATGCACATCAACAAGATGGACTGACACAAAATGATATTGCTAAAGCATTACAACGAACA
GGTCCAACTGTCAGTAATTTATTAAGGAACCTTGAACGTAAAAAGCTGATCTATCGCTAT
GTCGATGCACAAGATACGAGAAGAAAGAATATAGGGCTGACTACCTCTGGGATTAAACTC
GTAGAAGCATTCACTTCGATATTTGATGAAATGGAACAAACACTCGTATCGCAGTTATCT
GAAGAAGAAAATGAACAAATGAAAGCAAACTTAACTAAAATGTTATCTAGTTTACAATAA60
120
180
240
300
360
420
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS01855 [old locus tag: NWMN_0326 ]
- symbol: NWMN_RS01855
- description: multidrug efflux MATE transporter transcriptional repressor MepR
- length: 139
- theoretical pI: 6.26722
- theoretical MW: 16172.2
- GRAVY: -0.669784
⊟Function[edit | edit source]
- TIGRFAM: homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 40.9)and 5 moremobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 30)Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 22.8)Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 20.4)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 13.8)Regulatory functions DNA interactions aminoethylphosphonate catabolism associated LysR family transcriptional regulator (TIGR03339; HMM-score: 13.6)
- TheSEED: see NWMN_0326
- PFAM: HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 47.5)and 25 moreMarR; MarR family (PF01047; HMM-score: 37.6)Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 29.7)HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 21.9)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 21.6)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 19.8)HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 19.4)HTH_69; Winged helix-turn-helix domain (PF22979; HMM-score: 19.3)HxlR; HxlR-like helix-turn-helix (PF01638; HMM-score: 17.2)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 17.2)HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 17.2)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 16.1)HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 15.1)DUF6293_C; DUF6293 C-terminal winged helix domain (PF22665; HMM-score: 15)Crp; Bacterial regulatory proteins, crp family (PF00325; HMM-score: 14.7)no clan defined DUF445; Protein of unknown function (DUF445) (PF04286; HMM-score: 14.7)HTH (CL0123) Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 14.4)Penicillinase_R; Penicillinase repressor (PF03965; HMM-score: 14.3)DUF1670; Protein of unknown function (DUF1670) (PF07900; HMM-score: 14.3)B-block_TFIIIC; B-block binding subunit of TFIIIC (PF04182; HMM-score: 13.5)AAA_lid (CL0671) Vps4_C; Vps4 C terminal oligomerisation domain (PF09336; HMM-score: 13.5)HTH (CL0123) HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 13.5)HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 13.1)no clan defined DUF6664; Family of unknown function (DUF6664) (PF20369; HMM-score: 13)HTH (CL0123) HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 12.4)HrcA_DNA-bdg; Winged helix-turn-helix transcription repressor, HrcA DNA-binding (PF03444; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by MepR*, TF important in Multidrug resistance: see NWMN_0326
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9936
- Cytoplasmic Membrane Score: 0.0038
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0022
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005476
- TAT(Tat/SPI): 0.000487
- LIPO(Sec/SPII): 0.000763
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: MepR* see NWMN_0326
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]