From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS03615 [old locus tag: NWMN_0637 ]
  • pan locus tag?: SAUPAN002548000
  • symbol: NWMN_RS03615
  • pan gene symbol?: sarX
  • synonym:
  • product: MarR family transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS03615 [old locus tag: NWMN_0637 ]
  • symbol: NWMN_RS03615
  • product: MarR family transcriptional regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 721549..721974
  • length: 426
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (721549..721974) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGCTGAAAAATTTAAGATAATAATGACAGAAGCATTGTCTTTATATATTTGGGGGTGC
    AACATTTTGAATACTGAGAAATTAGAAACATTGCTTGGCTTCTATAAACAATATAAAGCA
    TTATCTGAATATATTGATAAAAAATATAAGTTGTCGCTAAATGATTTAGCAGTCTTAGAT
    TTAACGATGAAGCATTGCAAAGATGAAAAAGTACTTATGCAATCATTTTTAAAAACTGCA
    ATGGATGAGCTAGATTTAAGTAGGACAAAATTATTAGTTTCTATAAGAAGACTAATTGAA
    AAAGAAAGACTTAGTAAAGTTAGATCATCTAAAGATGAGCGTAAAATTTATATTTATTTA
    AATAATGATGATATATCTAAATTTAATGCTTTATTTGAAGATGTAGAACAATTTTTAAAT
    ATTTAA
    60
    120
    180
    240
    300
    360
    420
    426

Protein[edit | edit source]

Protein Data Bank: 5HS5

General[edit | edit source]

  • locus tag: NWMN_RS03615 [old locus tag: NWMN_0637 ]
  • symbol: NWMN_RS03615
  • description: MarR family transcriptional regulator
  • length: 141
  • theoretical pI: 8.62636
  • theoretical MW: 16717.5
  • GRAVY: -0.251064

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 108.2)
    and 1 more
    Genetic information processing Protein synthesis tRNA aminoacylation histidine--tRNA ligase (TIGR00442; EC 6.1.1.21; HMM-score: 10.8)
  • TheSEED:
  • PFAM:
    HTH (CL0123) RNA_pol_Rpc34; RNA polymerase Rpc34 subunit (PF05158; HMM-score: 18.1)
    and 1 more
    no clan defined HPS6; Hermansky-Pudlak syndrome 6 protein (PF15702; HMM-score: 13)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009607
    • TAT(Tat/SPI): 0.000534
    • LIPO(Sec/SPII): 0.173694
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_000818255 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MAEKFKIIMTEALSLYIWGCNILNTEKLETLLGFYKQYKALSEYIDKKYKLSLNDLAVLDLTMKHCKDEKVLMQSFLKTAMDELDLSRTKLLVSIRRLIEKERLSKVRSSKDERKIYIYLNNDDISKFNALFEDVEQFLNI

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]