Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS04830 [old locus tag: NWMN_0859 ]
- pan locus tag?: SAUPAN003136000
- symbol: NWMN_RS04830
- pan gene symbol?: opp-3F
- synonym:
- product: peptide ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS04830 [old locus tag: NWMN_0859 ]
- symbol: NWMN_RS04830
- product: peptide ABC transporter ATP-binding protein
- replicon: chromosome
- strand: +
- coordinates: 953880..954821
- length: 942
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901ATGAAAAATGATGAAGTGCTATTATCTATTAAAAATTTAAAGCAATATTTTAACGCAGGA
AAGAAAAACGAAGTGAGAGCGATTGAAAATATTTCGTTTGATATATACAAAGGGGAAACA
TTAGGTTTAGTAGGAGAATCGGGGTGTGGTAAATCTACAACTGGTAAATCAATTATTAAA
CTTAATGATATTACAAGTGGAGAAATTTTGTATGAGGGTATTGATATACAAAAGATTCGT
AAACGTAAAGATTTGCTTAAATTTAATAAAAAGATACAGATGATTTTTCAAGACCCATAT
GCGTCTTTAAATCCTAGGTTAAAAGTAATGGATATAGTAGCTGAAGGTATTGATATCCAT
CATTTAGCAACTGATAAGCGTGACCGAAAAAAACGTGTCTATGATTTACTTGAAACTGTT
GGATTAAGTAAAGAACATGCCAATCGCTATCCTCATGAATTTTCAGGTGGACAACGCCAA
CGTATTGGAATTGCCCGTGTATTAGCCGTTGAACCAGAATTCATTATCGCGGACGAACCA
ATATCGGCATTGGATGTTTCAATCCAAGCTCAAGTAGTTAATTTATTATTAAAATTACAA
CGTGAAAGAGGGATTACGTTCCTATTTATAGCTCATGATCTATCAATGGTGAAGTATATT
TCAGATCGTATTGCAGTCATGCATTTTGGGAAAATAGTTGAAATTGGACCGGCAGAAGAA
ATTTATCAAAATCCATTACACGATTATACTAAGTCTTTATTATCAGCCATTCCACAACCT
GATCCTGAATCAGAACGCAGTCGCAAACGATTTAGTTATATTGATGATGAAGCAAATAAT
CATTTAAGACAATTACATGAAATTAGACCGAATCACTTTGTCTTTAGTACTGAAGAAGAA
GCGGCACAACTACGAGAAAATAAATTGGTGACACAAAATTAA60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
942
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS04830 [old locus tag: NWMN_0859 ]
- symbol: NWMN_RS04830
- description: peptide ABC transporter ATP-binding protein
- length: 313
- theoretical pI: 8.39824
- theoretical MW: 35849.8
- GRAVY: -0.441214
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 238.6)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 192.4)and 70 moreTransport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 190.4)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 172.2)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 171.2)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 166.4)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 164.8)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 164)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 161)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 158.9)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 154.7)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 154.4)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 144.8)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 144)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 142.9)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 139.8)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 137.5)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 135.5)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 121.6)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 121.2)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 121.2)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 114.5)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 114.5)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 113.6)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 113.6)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 113.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 113.2)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 112.7)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 105.2)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 104.7)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 104.5)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 104.5)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 104.1)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 104.1)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 103.6)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 103.1)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 103.1)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 103)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 101)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 99.6)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 97)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 95.5)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 95)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 95)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 95)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 94.9)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 94.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 91.2)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 90.5)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 90.3)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 88.4)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 86.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 82.2)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 81.3)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 80.1)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 79.9)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 76.2)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 69)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 69)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 68.5)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 57.2)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 54.8)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 54.8)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 49.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 47.2)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 41.9)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 40.6)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 38.8)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 38.8)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 36.5)Transport and binding proteins Amino acids, peptides and amines oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain (TIGR01727; HMM-score: 34.6)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 28.4)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 116.4)and 10 moreno clan defined oligo_HPY; Oligopeptide/dipeptide transporter, C-terminal region (PF08352; HMM-score: 31.9)P-loop_NTPase (CL0023) SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 26.6)AAA_22; AAA domain (PF13401; HMM-score: 17.1)AIG1; AIG1 family (PF04548; HMM-score: 15.6)Glyco_hydro_tim (CL0058) Glyco_hydro_30; Glycosyl hydrolase family 30 TIM-barrel domain (PF02055; HMM-score: 14.9)P-loop_NTPase (CL0023) ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 14.7)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 14)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 13.6)AAA_18; AAA domain (PF13238; HMM-score: 13.5)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 10)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.04
- Cytoplasmic Membrane Score: 9.96
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.105461
- TAT(Tat/SPI): 0.001509
- LIPO(Sec/SPII): 0.00521
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKNDEVLLSIKNLKQYFNAGKKNEVRAIENISFDIYKGETLGLVGESGCGKSTTGKSIIKLNDITSGEILYEGIDIQKIRKRKDLLKFNKKIQMIFQDPYASLNPRLKVMDIVAEGIDIHHLATDKRDRKKRVYDLLETVGLSKEHANRYPHEFSGGQRQRIGIARVLAVEPEFIIADEPISALDVSIQAQVVNLLLKLQRERGITFLFIAHDLSMVKYISDRIAVMHFGKIVEIGPAEEIYQNPLHDYTKSLLSAIPQPDPESERSRKRFSYIDDEANNHLRQLHEIRPNHFVFSTEEEAAQLRENKLVTQN
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
NWMN_RS02965 elongation factor Tu [1] (data from MRSA252) NWMN_RS03640 LysR family transcriptional regulator [1] (data from MRSA252) NWMN_RS05395 dihydrolipoyl dehydrogenase [1] (data from MRSA252) NWMN_RS06210 cell division protein FtsZ [1] (data from MRSA252) NWMN_RS06490 50S ribosomal protein L19 [1] (data from MRSA252) NWMN_RS06575 30S ribosomal protein S2 [1] (data from MRSA252) NWMN_RS08930 pyruvate kinase [1] (data from MRSA252) NWMN_RS08995 universal stress protein UspA [1] (data from MRSA252) NWMN_RS11655 uracil phosphoribosyltransferase [1] (data from MRSA252) NWMN_RS12340 30S ribosomal protein S5 [1] (data from MRSA252) NWMN_RS12395 30S ribosomal protein S3 [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: CodY see NWMN_0859
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]