From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS05030 [old locus tag: NWMN_0898 ]
  • pan locus tag?: SAUPAN003214000
  • symbol: NWMN_RS05030
  • pan gene symbol?:
  • synonym:
  • product: DUF2187 domain-containing protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS05030 [old locus tag: NWMN_0898 ]
  • symbol: NWMN_RS05030
  • product: DUF2187 domain-containing protein
  • replicon: chromosome
  • strand: +
  • coordinates: 997977..998153
  • length: 177
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (997977..998153) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_0898

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGACTGTTGCAGAAGTGGGTAACATTGTTGAGTTTATGGATGGATTAAGAGGTCGTGTT
    GAAAAAATCAACGATAACTCTGTTATTGTTGACTTAACAATTATGGAAAATTTTAATGAC
    CTTGATTTACCGGAAAAAACTGTTATCAATCATAAACGATATAAGATTGTTGAATAA
    60
    120
    177

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS05030 [old locus tag: NWMN_0898 ]
  • symbol: NWMN_RS05030
  • description: DUF2187 domain-containing protein
  • length: 58
  • theoretical pI: 4.46294
  • theoretical MW: 6676.64
  • GRAVY: -0.17069

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein and peptide secretion and trafficking preprotein translocase, YajC subunit (TIGR00739; HMM-score: 13.6)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    no clan defined DUF2187; Uncharacterized protein conserved in bacteria (DUF2187) (PF09953; HMM-score: 97.6)
    and 3 more
    NTP_transf (CL0260) DUF2204; Nucleotidyl transferase of unknown function (DUF2204) (PF09970; HMM-score: 14.9)
    no clan defined YajC; Preprotein translocase subunit (PF02699; HMM-score: 13)
    Miga; Mitoguardin (PF10265; HMM-score: 11.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005589
    • TAT(Tat/SPI): 0.000407
    • LIPO(Sec/SPII): 0.001709
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTVAEVGNIVEFMDGLRGRVEKINDNSVIVDLTIMENFNDLDLPEKTVINHKRYKIVE

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:
    NWMN_RS04380arsenate reductase  [1] (data from MRSA252)
    NWMN_RS0838030S ribosomal protein S20  [1] (data from MRSA252)
    NWMN_RS090102-Cys peroxiredoxin  [1] (data from MRSA252)
    NWMN_RS11735DNA-directed RNA polymerase subunit delta  [1] (data from MRSA252)
    NWMN_RS1234030S ribosomal protein S5  [1] (data from MRSA252)

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.0 1.1 1.2 1.3 1.4 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]