From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS05190 [old locus tag: NWMN_0927 ]
  • pan locus tag?: SAUPAN003267000
  • symbol: NWMN_RS05190
  • pan gene symbol?: qoxD
  • synonym:
  • product: quinol oxidase subunit 4

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS05190 [old locus tag: NWMN_0927 ]
  • symbol: NWMN_RS05190
  • product: quinol oxidase subunit 4
  • replicon: chromosome
  • strand: -
  • coordinates: 1029369..1029659
  • length: 291
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (1029369..1029659) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_0927

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAGTACAATAATGAAACATACTGTAGGATTTATCGCATCTATCGTATTAACGCTTTTA
    GCAGTTTACGTAACACTATACACGTCATTAACATTCCACGCGAAGTTGACAATTATCTTT
    GGCTTTGCATTCGTCCAAGCAGGACTTCAATTATTAATGTTCATGCATTTAACTGAAGGT
    AAAGATGGACGTTTACAAACATTCAAAGTTATCTTTGCTCTTGTAATTACACTTTGTTTC
    GTTGTCGGAACATATTGGGTTATGCAAGGCGGTCACTCTTCACACTTATAA
    60
    120
    180
    240
    291


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS05190 [old locus tag: NWMN_0927 ]
  • symbol: NWMN_RS05190
  • description: quinol oxidase subunit 4
  • length: 96
  • theoretical pI: 9.69391
  • theoretical MW: 10686.8
  • GRAVY: 1.01979

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Electron transport cytochrome aa3 quinol oxidase, subunit IV (TIGR02901; EC 1.10.3.-; HMM-score: 104.3)
    and 3 more
    Metabolism Energy metabolism Electron transport cytochrome o ubiquinol oxidase subunit IV (TIGR02847; EC 1.10.3.-; HMM-score: 55.5)
    Metabolism Energy metabolism Electron transport caa(3)-type oxidase, subunit IV (TIGR02229; HMM-score: 16.8)
    Metabolism Energy metabolism Electron transport cytochrome c oxidase, subunit IVB (TIGR02908; EC 1.9.3.1; HMM-score: 15.5)
  • TheSEED: see NWMN_0927
  • PFAM:
    no clan defined COX4_pro; Prokaryotic Cytochrome C oxidase subunit IV (PF03626; HMM-score: 46.8)
    and 4 more
    Rhomboid-like (CL0207) Rhomboid; Rhomboid family (PF01694; HMM-score: 14.2)
    MtN3-like (CL0141) MtN3_slv; Sugar efflux transporter for intercellular exchange (PF03083; HMM-score: 14)
    no clan defined DUF5654; Family of unknown function (DUF5654) (PF18898; HMM-score: 10.1)
    DUF6442; Family of unknown function (DUF6442) (PF20040; HMM-score: 7.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9998
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0002
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005989
    • TAT(Tat/SPI): 0.00029
    • LIPO(Sec/SPII): 0.002534
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEGKDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]