From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS08100 [old locus tag: NWMN_1435 ]
  • pan locus tag?: SAUPAN004108000
  • symbol: NWMN_RS08100
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS08100 [old locus tag: NWMN_1435 ]
  • symbol: NWMN_RS08100
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1606169..1606750
  • length: 582
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (1606169..1606750) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1435

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAAAAAATTGGTTTCAATTGTTGGCGCAACATTATTGTTAGCTGGATGTGGATCACAA
    AATTTAGCACCATTAGAAGAAAAAACAACAGATTTAAGAGAAGATAATCATCAACTCAAA
    CTAGATATTCAAGAACTTAATCAACAAATTAGTGATTCTAAATCTAAAATTAAAGGGCTT
    GAAAAGGATAAAGAAAACAGTAAAAAAACTGCATCTAATAATACGAAAATTAAATTGATG
    AATGTTACATCAACATACTACGACAAAGTTGCTAAAGCTTTGAAATCCTATAACGATATT
    GAGAAAGATGTAAGTAAAAACAAAGGCGATAAGAATGTTCAATCGAAATTAAATCAAATT
    TCTAATGATATTCAAAGTGCTCACACTTCATACAAAGATGCTATCGATGGTTTATCACTT
    AGTGATGATGATAAAAAAACGTCTAAAAATATCGATAAATTAAACTCTGATTTGAATCAT
    GCATTTGATGATATTAAAAATGGCTATCAAAATAAAGATAAAAAACAACTTACAAAAGGA
    CAACAAGCGTTGTCAAAATTAAACTTAAATGCAAAATCATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    582


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS08100 [old locus tag: NWMN_1435 ]
  • symbol: NWMN_RS08100
  • description: hypothetical protein
  • length: 193
  • theoretical pI: 9.8465
  • theoretical MW: 21472
  • GRAVY: -0.999482

Function[edit | edit source]

  • TIGRFAM:
    SH3 domain protein (TIGR04211; HMM-score: 14.2)
    and 6 more
    Cellular processes Cellular processes Pathogenesis type III secretion apparatus needle protein (TIGR02105; HMM-score: 11.3)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type III secretion apparatus needle protein (TIGR02105; HMM-score: 11.3)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion membrane fusion protein, HlyD family (TIGR01843; HMM-score: 11.2)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions integrating conjugative element protein, PFL_4705 family (TIGR03752; HMM-score: 7.3)
    phage lysis regulatory protein, LysB family (TIGR03495; HMM-score: 5.8)
    Metabolism Energy metabolism Photosynthesis photosystem II protein PsbQ (TIGR03042; HMM-score: 5.1)
  • TheSEED: see NWMN_1435
  • PFAM:
    Transthyretin (CL0287) T6_Ig_like; T6 antigen Ig like domain (PF18002; HMM-score: 16.9)
    LppaM (CL0421) LPAM_1; Prokaryotic membrane lipoprotein lipid attachment site (PF08139; HMM-score: 15.8)
    no clan defined TMCO5; TMCO5 family (PF14992; HMM-score: 15.6)
    DUF7449; Domain of unknown function (DUF7449) (PF24242; HMM-score: 14.1)
    OML_zippers (CL0590) LPP; Lipoprotein leucine-zipper (PF04728; HMM-score: 14)
    no clan defined DUF6317; Family of unknown function (DUF6317) (PF19840; HMM-score: 13.6)
    and 19 more
    DUF4763; Domain of unknown function (DUF4763) (PF15960; HMM-score: 13.5)
    YabA; Initiation control protein YabA (PF06156; HMM-score: 13.2)
    EsxAB (CL0352) Hydro_N_hd; Hydrolase N-terminal helical domain (PF22905; HMM-score: 13)
    DUF5344; Family of unknown function (DUF5344) (PF17279; HMM-score: 12.9)
    no clan defined DUF1664; Protein of unknown function (DUF1664) (PF07889; HMM-score: 12.3)
    LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 11.7)
    no clan defined MRPL52; Mitoribosomal protein mL52 (PF18699; HMM-score: 10.8)
    LemA; LemA family (PF04011; HMM-score: 10)
    PoNi_N; PoNe immunity protein (PoNi), N-terminal (PF08928; HMM-score: 9.6)
    Uso1_p115_C; Uso1 / p115 like vesicle tethering protein, C terminal region (PF04871; HMM-score: 9.2)
    FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 8.6)
    APG6_N; Apg6 coiled-coil region (PF17675; HMM-score: 8.3)
    Cnn_1N; Centrosomin N-terminal motif 1 (PF07989; HMM-score: 8.1)
    Ax_dynein_light; Axonemal dynein light chain (PF10211; HMM-score: 7.9)
    bZIP (CL0018) bZIP_1; bZIP transcription factor (PF00170; HMM-score: 7.4)
    MazG (CL0231) Nuf2_DHR10-like; Nuf2, DHR10-like domain (PF18595; HMM-score: 7.4)
    no clan defined GrpE; GrpE (PF01025; HMM-score: 7.3)
    RPW8; Arabidopsis broad-spectrum mildew resistance protein RPW8 (PF05659; HMM-score: 6.9)
    Prominin; Prominin (PF05478; HMM-score: 4.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.6328
    • Cell wall & surface Score: 0.0317
    • Extracellular Score: 0.3354
  • LocateP:
  • SignalP: Signal peptide LIPO(Sec/SPII) length 16 aa
    • SP(Sec/SPI): 0.000578
    • TAT(Tat/SPI): 0.000055
    • LIPO(Sec/SPII): 0.999143
    • Cleavage Site: CS pos: 16-17. LAG-CG. Pr: 0.9997
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKKLVSIVGATLLLAGCGSQNLAPLEEKTTDLREDNHQLKLDIQELNQQISDSKSKIKGLEKDKENSKKTASNNTKIKLMNVTSTYYDKVAKALKSYNDIEKDVSKNKGDKNVQSKLNQISNDIQSAHTSYKDAIDGLSLSDDDKKTSKNIDKLNSDLNHAFDDIKNGYQNKDKKQLTKGQQALSKLNLNAKS

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]