From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS09340 [old locus tag: NWMN_1664 ]
  • pan locus tag?: SAUPAN004463000
  • symbol: NWMN_RS09340
  • pan gene symbol?: arsR
  • synonym:
  • product: transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS09340 [old locus tag: NWMN_1664 ]
  • symbol: NWMN_RS09340
  • product: transcriptional regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 1861307..1861621
  • length: 315
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (1861307..1861621) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1664

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGACGTATAAAGAACTAGCAACATTTTTAAAAGTTTTATCAGATTCAAGCAGATTAGAA
    ATACTAGATTTACTTTCTTGTGGAGAGTTATGCGCTTGTGATTTGTTAGCACATTTTCAA
    TTCTCTCAACCTACACTTAGCTATCATATGAAAGCATTAGTAAAAACCAACTTAGTTACG
    ACACGAAAAATCGGAAATAAACATTTATACCAGCTCAATCATAATATTTTTGAGTCCGTA
    ATTAATAACTTGTCTAAGGTTCATACCTCTAACCAACGATGTATTTGTCATAACCTTAAG
    ACTGGTGAATGCTAA
    60
    120
    180
    240
    300
    315

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS09340 [old locus tag: NWMN_1664 ]
  • symbol: NWMN_RS09340
  • description: transcriptional regulator
  • length: 104
  • theoretical pI: 8.38639
  • theoretical MW: 11840.7
  • GRAVY: -0.0778846

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 11.8)
  • TheSEED: see NWMN_1664
  • PFAM:
    HTH (CL0123) HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 54.8)
    and 6 more
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 30.5)
    Dimerisation; Plant O-methyltransferase dimerisation domain (PF08100; HMM-score: 21.2)
    MarR_2; MarR family (PF12802; HMM-score: 13.6)
    MarR; MarR family (PF01047; HMM-score: 12.9)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 12.8)
    no clan defined GAAD; GTPase-associated adaptor domain (PF19976; HMM-score: 11.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • genes regulated by ArsR*, TF important in Arsenic resistance: see NWMN_1664

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9936
    • Cytoplasmic Membrane Score: 0.0003
    • Cell wall & surface Score: 0.0008
    • Extracellular Score: 0.0054
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.025855
    • TAT(Tat/SPI): 0.003566
    • LIPO(Sec/SPII): 0.067076
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTYKELATFLKVLSDSSRLEILDLLSCGELCACDLLAHFQFSQPTLSYHMKALVKTNLVTTRKIGNKHLYQLNHNIFESVINNLSKVHTSNQRCICHNLKTGEC

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]