Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_01891
- pan locus tag?: SAUPAN004463000
- symbol: SAOUHSC_01891
- pan gene symbol?: arsR
- synonym:
- product: arsenate operon regulator
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_01891
- symbol: SAOUHSC_01891
- product: arsenate operon regulator
- replicon: chromosome
- strand: +
- coordinates: 1804468..1804782
- length: 315
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3920839 NCBI
- RefSeq: YP_500393 NCBI
- BioCyc: G1I0R-1758 BioCyc
- MicrobesOnline: 1290307 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGACGTATAAAGAACTAGCAACATTTTTAAAAGTTTTATCAGATTCAAGCAGATTAGAA
ATACTAGATTTACTTTCTTGTGGAGAGTTATGCGCTTGTGATTTGTTAGCACATTTTCAA
TTCTCTCAACCTACACTTAGCTATCATATGAAAGCATTAGTAAAAACCAACTTAGTTACG
ACACGAAAAATCGGAAATAAACATTTATACCAGCTCAATCATAATATTTTTGAGTCCGTA
ATTAATAACTTGTCTAAGGTTCATACCTCTAACCAACGATGTATTTGTCATAACCTTAAG
ACTGGTGAATGCTAA60
120
180
240
300
315
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_01891
- symbol: SAOUHSC_01891
- description: arsenate operon regulator
- length: 104
- theoretical pI: 8.38639
- theoretical MW: 11840.7
- GRAVY: -0.0778846
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 11.8)
- TheSEED :
- Arsenical resistance operon repressor
- PFAM: HTH (CL0123) HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 54.8)and 6 moreHTH_20; Helix-turn-helix domain (PF12840; HMM-score: 30.5)Dimerisation; Plant O-methyltransferase dimerisation domain (PF08100; HMM-score: 21.2)MarR_2; MarR family (PF12802; HMM-score: 13.6)MarR; MarR family (PF01047; HMM-score: 12.9)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 12.8)no clan defined GAAD; GTPase-associated adaptor domain (PF19976; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors: Arsenate; Arsenite
- genes regulated by ArsR*, TF important in Arsenic resistanceRegPrecisetranscription unit transferred from N315 data RegPrecise
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9936
- Cytoplasmic Membrane Score: 0.0003
- Cell wall & surface Score: 0.0008
- Extracellular Score: 0.0054
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.025855
- TAT(Tat/SPI): 0.003566
- LIPO(Sec/SPII): 0.067076
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTYKELATFLKVLSDSSRLEILDLLSCGELCACDLLAHFQFSQPTLSYHMKALVKTNLVTTRKIGNKHLYQLNHNIFESVINNLSKVHTSNQRCICHNLKTGEC
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: ArsR* (repression) regulon
ArsR* (TF) important in Arsenic resistance; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [1]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
