From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS10820 [old locus tag: NWMN_1882 ]
  • pan locus tag?: SAUPAN005030000
  • symbol: NWMN_RS10820
  • pan gene symbol?:
  • synonym:
  • product: holin

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS10820 [old locus tag: NWMN_1882 ]
  • symbol: NWMN_RS10820
  • product: holin
  • replicon: chromosome
  • strand: -
  • coordinates: 2093446..2093700
  • length: 255
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (2093446..2093700) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1882

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGATTAATTGGAAAATTAGAATGAAACAAAAATCATTTTGGGTAGCGATATTGTCAGCT
    ATCTTTTTATTTGCTCAAAACATCGCAAAAGCTATTGGGTATGATATCCAAGTTTATACA
    GAGCAATTAACAGACGGTTTAAACGCTATATTAGGATTTTTAGTATTAACTGGTGTGATT
    CAAGACCCGACTACTAAAGGTATAGGTGATAGCCACCAAGCTTTAGAATATGAAGAACCA
    AGAAGAAAATACTAG
    60
    120
    180
    240
    255

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS10820 [old locus tag: NWMN_1882 ]
  • symbol: NWMN_RS10820
  • description: holin
  • length: 84
  • theoretical pI: 8.92064
  • theoretical MW: 9591.08
  • GRAVY: 0.0202381

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Mobile and extrachromosomal element functions Prophage functions holin, phage phi LC3 family (TIGR01598; HMM-score: 86.6)
  • TheSEED: see NWMN_1882
  • PFAM:
    no clan defined Phage_holin_1; Bacteriophage holin (PF04531; HMM-score: 99.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0009
    • Cytoplasmic Membrane Score: 0.9701
    • Cell wall & surface Score: 0.0008
    • Extracellular Score: 0.0282
  • LocateP:
  • SignalP: Signal peptide SP(Sec/SPI) length 31 aa
    • SP(Sec/SPI): 0.89249
    • TAT(Tat/SPI): 0.003745
    • LIPO(Sec/SPII): 0.00839
    • Cleavage Site: CS pos: 31-32. AKA-IG. Pr: 0.7707
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MINWKIRMKQKSFWVAILSAIFLFAQNIAKAIGYDIQVYTEQLTDGLNAILGFLVLTGVIQDPTTKGIGDSHQALEYEEPRRKY

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]