From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS11210 [old locus tag: NWMN_1943 ]
  • pan locus tag?: SAUPAN005275000
  • symbol: NWMN_RS11210
  • pan gene symbol?: agrB
  • synonym:
  • product: accessory gene regulator AgrB

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS11210 [old locus tag: NWMN_1943 ]
  • symbol: NWMN_RS11210
  • product: accessory gene regulator AgrB
  • replicon: chromosome
  • strand: +
  • coordinates: 2151521..2152090
  • length: 570
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (2151521..2152090) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    TTGAATTATTTTGATAATAAAATTGACCAGTTTGCCACGTATCTTCAAAAGAGAAATAAC
    TTAGATCATATTCAATTTTTGCAAGTACGATTAGGGATGCAGGTCTTAGCTAAAAATATA
    GGTAAATTAATTGTTATGTATACTATTGCCTATATTTTAAACATTTTTCTGTTTACGTTA
    ATTACGAATTTAACATTTTATTTAATAAGAAGACATGCACATGGTGCACATGCACCTTCT
    TCTTTTTGGTGTTATGTAGAAAGTATTATACTATTTATACTTTTACCTTTAGTAATAGTA
    AATTTTCATATTAACTTTTTAATTATGATTATTTTAACAGTTATTTCTTTAGGTGTAATC
    TCAGTATATGCTCCTGCAGCAACTAAAAAGAAGCCCATTCCTGTGCGACTTATTAAACGA
    AAAAAATATTATGCGATTATTGTTAGTTTAACCCTTTTCATTATCACACTTATCATCAAA
    GAGCCATTTGCCCAATTCATTCAATTAGGCATCATAATAGAAGCTATTACATTATTACCT
    ATTTTCTTTATTAAGGAGGACTTAAAATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    570

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS11210 [old locus tag: NWMN_1943 ]
  • symbol: NWMN_RS11210
  • description: accessory gene regulator AgrB
  • length: 189
  • theoretical pI: 10.3336
  • theoretical MW: 21929.5
  • GRAVY: 0.827513

Function[edit | edit source]

  • reaction:
    EC 3.4.-.-?  ExPASy
  • TIGRFAM:
    cxxc_20_cxxc protein (TIGR04104; HMM-score: 6.7)
  • TheSEED:
  • PFAM:
    no clan defined AgrB; Accessory gene regulator B (PF04647; HMM-score: 114.5)
    and 1 more
    DUF4400; Domain of unknown function (DUF4400) (PF14348; HMM-score: 12.8)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003149
    • TAT(Tat/SPI): 0.000096
    • LIPO(Sec/SPII): 0.033947
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit | edit source]

  • GI: 447028451 NCBI
  • RefSeq: WP_001105707 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MNYFDNKIDQFATYLQKRNNLDHIQFLQVRLGMQVLAKNIGKLIVMYTIAYILNIFLFTLITNLTFYLIRRHAHGAHAPSSFWCYVESIILFILLPLVIVNFHINFLIMIILTVISLGVISVYAPAATKKKPIPVRLIKRKKYYAIIVSLTLFIITLIIKEPFAQFIQLGIIIEAITLLPIFFIKEDLK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]