From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS11345 [old locus tag: NWMN_1966 ]
  • pan locus tag?: SAUPAN005310000
  • symbol: NWMN_RS11345
  • pan gene symbol?: leuD
  • synonym:
  • product: 3-isopropylmalate dehydratase small subunit

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS11345 [old locus tag: NWMN_1966 ]
  • symbol: NWMN_RS11345
  • product: 3-isopropylmalate dehydratase small subunit
  • replicon: chromosome
  • strand: +
  • coordinates: 2178325..2178897
  • length: 573
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (2178325..2178897) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGGCAGCAATCAAACCTATTACAACATATAAAGGTAAAATAGTCCCTCTCTTCAACGAC
    AATATCGATACAGACCAAATCATTCCTAAGGTACACTTAAAGCGTATTTCAAAAAGTGGC
    TTTGGTCCATTTGCTTTTGATGAATGGCGGTACTTACCTGATGGTTCAGATAATCCTGAT
    TTCAATCCTAACAAACCACAATATAAAGGGGCTTCTATTTTAATTACTGGAGATAATTTT
    GGATGTGGTTCAAGTCGTGAACATGCTGCTTGGGCTCTTAAGGACTATGGTTTTCATATT
    ATTATTGCAGGAAGTTTCAGTGACATATTTTATATGAATTGCACTAAAAATGCGATGTTG
    CCTATCGTTTTAGAAAAAAGTGCCCGTGAACATCTTGCACAATATGTTGAAATTGAGGTC
    GATTTACCAAATCAAACTGTGTCATCACCAGACAAGCGTTTCCATTTTGAAATTGATGAA
    ACTTGGAAGAATAAACTTGTAAATGGCTTAGATGACATTGCAATCACCCTACAATATGAA
    TCATTAATAGAAAAATATGAAAAATCACTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    573

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS11345 [old locus tag: NWMN_1966 ]
  • symbol: NWMN_RS11345
  • description: 3-isopropylmalate dehydratase small subunit
  • length: 190
  • theoretical pI: 5.63012
  • theoretical MW: 21578.4
  • GRAVY: -0.356842

Function[edit | edit source]

  • reaction:
    EC 4.2.1.33?  ExPASy
    3-isopropylmalate dehydratase (2R,3S)-3-isopropylmalate = (2S)-2-isopropylmalate
  • TIGRFAM:
    Metabolism Amino acid biosynthesis Pyruvate family 3-isopropylmalate dehydratase, small subunit (TIGR00171; EC 4.2.1.33; HMM-score: 223.5)
    and 7 more
    3-isopropylmalate dehydratase, small subunit (TIGR02087; HMM-score: 83.1)
    Metabolism Amino acid biosynthesis Pyruvate family 3-isopropylmalate dehydratase, small subunit (TIGR02084; EC 4.2.1.33; HMM-score: 80)
    Metabolism Energy metabolism TCA cycle putative aconitate hydratase (TIGR01342; EC 4.2.1.3; HMM-score: 48.1)
    Metabolism Amino acid biosynthesis Aspartate family homoaconitase (TIGR00139; EC 4.2.1.36; HMM-score: 40.1)
    Metabolism Energy metabolism TCA cycle aconitate hydratase, mitochondrial (TIGR01340; EC 4.2.1.3; HMM-score: 29)
    Metabolism Energy metabolism TCA cycle aconitate hydratase 1 (TIGR01341; EC 4.2.1.3; HMM-score: 27.6)
    2-methylisocitrate dehydratase, Fe/S-dependent (TIGR02333; EC 4.2.1.99; HMM-score: 17.2)
  • TheSEED:
  • PFAM:
    Leu-IlvD (CL0364) Aconitase_C; Aconitase C-terminal domain (PF00694; HMM-score: 115.9)
    and 1 more
    Aconitase_2_N; Aconitate hydratase 2 N-terminus (PF06434; HMM-score: 12.2)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002721
    • TAT(Tat/SPI): 0.000148
    • LIPO(Sec/SPII): 0.000422
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446641609 NCBI
  • RefSeq: WP_000718955 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MAAIKPITTYKGKIVPLFNDNIDTDQIIPKVHLKRISKSGFGPFAFDEWRYLPDGSDNPDFNPNKPQYKGASILITGDNFGCGSSREHAAWALKDYGFHIIIAGSFSDIFYMNCTKNAMLPIVLEKSAREHLAQYVEIEVDLPNQTVSSPDKRFHFEIDETWKNKLVNGLDDIAITLQYESLIEKYEKSL

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]