Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS12370 [old locus tag: NWMN_2141 ]
- pan locus tag?: SAUPAN005691000
- symbol: NWMN_RS12370
- pan gene symbol?: rplX
- synonym:
- product: 50S ribosomal protein L24
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS12370 [old locus tag: NWMN_2141 ]
- symbol: NWMN_RS12370
- product: 50S ribosomal protein L24
- replicon: chromosome
- strand: -
- coordinates: 2369998..2370315
- length: 318
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_009641 (2369998..2370315) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGCATATCAAAAAAGGTGACAACGTTAAAGTTATCGCAGGTAAAGACAAAGGTAAAGAA
GGTAAAGTAATTGCTACTCTACCTAAAAAAGACCGTGTCGTTGTGGAAGGTGTTAACATT
ATGAAAAAACACCAAAAACCAACTCAATTAAATCCTGAAGGTGGAATCTTAGAAACAGAG
GCAGCAATCCATGTTTCTAATGTACAATTATTGGACCCTAAAACAAACGAACCAACTCGT
GTAGGTTACAAATTTGTTGATGGTAAAAAAGTTCGTATCGCTAAAAAATCTGGCGAAGAA
ATTAAATCTAATAATTAA60
120
180
240
300
318
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: NWMN_RS12370 [old locus tag: NWMN_2141 ]
- symbol: NWMN_RS12370
- description: 50S ribosomal protein L24
- length: 105
- theoretical pI: 10.5873
- theoretical MW: 11536.4
- GRAVY: -0.722857
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL24 (TIGR01079; HMM-score: 136.5)and 3 moreProtein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL24 (TIGR01080; HMM-score: 32.2)transcription elongation factor Spt5 (TIGR00405; HMM-score: 17.5)HAD phosphatase, family IIIB (TIGR01672; EC 3.1.3.-; HMM-score: 13.1)
- TheSEED:
- PFAM: no clan defined ribosomal_L24; Ribosomal proteins 50S L24/mitochondrial 39S L24 (PF17136; HMM-score: 106.1)and 1 moreKOW (CL0107) KOW; KOW motif (PF00467; HMM-score: 34.1)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
NWMN_RS02105 alkyl hydroperoxide reductase subunit C [1] (data from MRSA252) NWMN_RS02915 50S ribosomal protein L1 [1] (data from MRSA252) NWMN_RS02920 50S ribosomal protein L10 [1] (data from MRSA252) NWMN_RS02925 50S ribosomal protein L7/L12 [1] (data from MRSA252) NWMN_RS03640 LysR family transcriptional regulator [1] (data from MRSA252) NWMN_RS04590 NADH dehydrogenase [1] (data from MRSA252) NWMN_RS05380 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) NWMN_RS05385 pyruvate dehydrogenase E1 component subunit beta [1] (data from MRSA252) NWMN_RS05390 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [1] (data from MRSA252) NWMN_RS05395 dihydrolipoyl dehydrogenase [1] (data from MRSA252) NWMN_RS06210 cell division protein FtsZ [1] (data from MRSA252) NWMN_RS06490 50S ribosomal protein L19 [1] (data from MRSA252) NWMN_RS06575 30S ribosomal protein S2 [1] (data from MRSA252) NWMN_RS07455 dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex [1] (data from MRSA252) NWMN_RS07460 2-oxoglutarate dehydrogenase E1 component [1] (data from MRSA252) NWMN_RS07785 DNA-binding protein HU [1] (data from MRSA252) NWMN_RS08350 molecular chaperone DnaK [1] (data from MRSA252) NWMN_RS08685 50S ribosomal protein L21 [1] (data from MRSA252) NWMN_RS08795 trigger factor [1] (data from MRSA252) NWMN_RS08930 pyruvate kinase [1] (data from MRSA252) NWMN_RS08995 universal stress protein UspA [1] (data from MRSA252) NWMN_RS12080 Asp23/Gls24 family envelope stress response protein [1] (data from MRSA252) NWMN_RS12300 30S ribosomal protein S11 [1] (data from MRSA252) NWMN_RS12330 50S ribosomal protein L15 [1] (data from MRSA252)
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008389
- TAT(Tat/SPI): 0.000477
- LIPO(Sec/SPII): 0.002161
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MHIKKGDNVKVIAGKDKGKEGKVIATLPKKDRVVVEGVNIMKKHQKPTQLNPEGGILETEAAIHVSNVQLLDPKTNEPTRVGYKFVDGKKVRIAKKSGEEIKSNN
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]