Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0662
- pan locus tag?: SAUPAN002593000
- symbol: SA0662
- pan gene symbol?: saeQ
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0662
- symbol: SA0662
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 756996..757178
- length: 183
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123469 NCBI
- RefSeq: NP_373917 NCBI
- BioCyc:
- MicrobesOnline: 102943 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATAAATTATATCTTAGCAGATATGATATTTACGTATCCTCTTCAATTAACTTTCTTT
ATCCTTTTACTAATGAGTCACTCATTGTTAAAACAGATTTCACTTAAAGAAATCATTAAT
TACTTTAGAGGTCGTAAGAACAGAGGTGAAAAAATAGATGACCCACTTACTGATCGTGGA
TGA60
120
180
183
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0662
- symbol: SA0662
- description: hypothetical protein
- length: 60
- theoretical pI: 9.66267
- theoretical MW: 7119.42
- GRAVY: 0.0766667
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01108426: hypothetical protein
- PFAM: TPR (CL0020) HEAT_ATR; Serine/threonine-protein kinase ATR-like, HEAT repeats (PF23593; HMM-score: 14.2)Triple_barrel (CL0662) RNase_H2_suC; Ribonuclease H2 non-catalytic subunit (Ylr154p-like) (PF08615; HMM-score: 13)no clan defined MotB_plug; Membrane MotB of proton-channel complex MotA/MotB (PF13677; HMM-score: 13)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0041
- Cytoplasmic Membrane Score: 0.9621
- Cell wall & surface Score: 0
- Extracellular Score: 0.0338
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 4
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.101357
- TAT(Tat/SPI): 0.001291
- LIPO(Sec/SPII): 0.019422
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MINYILADMIFTYPLQLTFFILLLMSHSLLKQISLKEIINYFRGRKNRGEKIDDPLTDRG
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: saeS < saeR < SA0662
⊟Regulation[edit | edit source]
- regulator: SaeR (activation) regulon
SaeR (TF) important in Virulence; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]