From AureoWiki
Jump to: navigation, search

NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0663 [new locus tag: SA_RS03780 ]
  • pan locus tag?: SAUPAN002594000
  • symbol: SA0663
  • pan gene symbol?: saeP
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0663 [new locus tag: SA_RS03780 ]
  • symbol: SA0663
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 757812..758252
  • length: 441
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAATACAAAATATTTTTTAGCAGTTGGTGCTGTTGCCTCTGTATTAACTTTAGGCGCT
    TGTGGTAATTCTAATTCACAAGATCAAGGTAACAAAACTGAACAAAAAACAAAGTCAGAA
    GATAGCAATGTTAAAACTGATAAAACAAAACACCTAACAGGTACATTCAGTTCTAAAAAC
    GGTGAAACTGTTGAAGGTAAAGCTGAGATTAAAAATGGTAAATTAATGCTTACTAACTAC
    AAATCATCAAAAGGTCCAGATTTATACGTCTACCTAACAAAAAATGGCGACATTAAAAAC
    GGTAAAGAAATCGCAATGGTTGACTACGATAAAGAAAAACAAACATTTGATCTTAAAAAT
    GTAGATTTAAGCAAATATGATGAAGTAACAATCTATTGTAAAAAAGCTCACGTCATCTTC
    GGCGGCGCTAAATTAAAATAA
    60
    120
    180
    240
    300
    360
    420
    441

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0663 [new locus tag: SA_RS03780 ]
  • symbol: SA0663
  • description: hypothetical protein
  • length: 146
  • theoretical pI: 9.62012
  • theoretical MW: 16045.1
  • GRAVY: -0.725342

Function[edit source | edit]

  • TIGRFAM:
  • TheSEED:  
    FIG01107853: hypothetical protein
  • PFAM:
    no clan definedDM13; Electron transfer DM13 (PF10517; HMM-score: 42)
    and 4 more
    DUF1797; Protein of unknown function (DUF1797) (PF08796; HMM-score: 15.9)
    CfAFP; Choristoneura fumiferana antifreeze protein (CfAFP) (PF05264; HMM-score: 14)
    YcgL; YcgL domain (PF05166; HMM-score: 12.6)
    LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 10.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: -0.33
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: LTLGACG
  • SignalP: Signal peptide LIPO(Sec/SPII) length 20 aa
    • SP(Sec/SPI): 0.000794
    • TAT(Tat/SPI): 0.000101
    • LIPO(Sec/SPII): 0.998882
    • Cleavage Site: CS pos: 20-21. LGA-CG. Pr: 0.9993
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNTKYFLAVGAVASVLTLGACGNSNSQDQGNKTEQKTKSEDSNVKTDKTKHLTGTFSSKNGETVEGKAEIKNGKLMLTNYKSSKGPDLYVYLTKNGDIKNGKEIAMVDYDKEKQTFDLKNVDLSKYDEVTIYCKKAHVIFGGAKLK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA0663 no polycistronic organisation predicted

Regulation[edit source | edit]

  • regulator: SaeR (activation) regulon
    SaeR(TF)important in Virulence; RegPrecise  

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]