From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0768 [new locus tag: SACOL_RS03945 ]
  • pan locus tag?: SAUPAN002594000
  • symbol: SACOL0768
  • pan gene symbol?: saeP
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0768 [new locus tag: SACOL_RS03945 ]
  • symbol: SACOL0768
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 790262..790702
  • length: 441
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAATACAAAATATTTTTTAGCAGCTGGTGCTGTTATCACAACATTAGCTTTAGGTGCT
    TGTGGTAATTCTAATTCACAAGATCAAGGTAACAAAACTGAACAAAAAACAAAGTCAGAA
    GATAGCAATGTTAAAACTGATAAAACAAAACACCTAACAGGTACATTCAGTTCTAAAAAC
    GGTGAAACTGTTGAAGGTAAAGCTGAGATTAAAAATGGTAAATTAATGCTTACTAACTAC
    AAATCATCAAAAGGTCCAGATTTATACGTCTACCTAACAAAAAATGGCGACATTAAAAAC
    GGTAAAGAAATCGCAATGGTTGACTACGATAAAGAAAAACAAACATTTGATCTTAAAAAT
    GTAGATTTAAGCAAATATGATGAAGTAACAATCTATTGTAAAAAAGCTCACGTCATCTTC
    GGCGGCGCTAAATTAAAATAA
    60
    120
    180
    240
    300
    360
    420
    441


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL0768 [new locus tag: SACOL_RS03945 ]
  • symbol: SACOL0768
  • description: hypothetical protein
  • length: 146
  • theoretical pI: 9.62012
  • theoretical MW: 16045.1
  • GRAVY: -0.739041

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01107853: hypothetical protein
  • PFAM:
    no clan defined DM13; Electron transfer DM13 (PF10517; HMM-score: 43)
    and 4 more
    DUF1797; Protein of unknown function (DUF1797) (PF08796; HMM-score: 16.4)
    YcgL; YcgL domain (PF05166; HMM-score: 12.6)
    CfAFP; Choristoneura fumiferana antifreeze protein (CfAFP) (PF05264; HMM-score: 12.2)
    OB (CL0021) RPA43_OB; RPA43 OB domain in RNA Pol I (PF17875; HMM-score: 11.5)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.7989
    • Cell wall & surface Score: 0.0089
    • Extracellular Score: 0.1921
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: -0.33
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: LALGACG
  • SignalP: Signal peptide LIPO(Sec/SPII) length 20 aa
    • SP(Sec/SPI): 0.00076
    • TAT(Tat/SPI): 0.00011
    • LIPO(Sec/SPII): 0.998886
    • Cleavage Site: CS pos: 20-21. LGA-CG. Pr: 0.9994
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MNTKYFLAAGAVITTLALGACGNSNSQDQGNKTEQKTKSEDSNVKTDKTKHLTGTFSSKNGETVEGKAEIKNGKLMLTNYKSSKGPDLYVYLTKNGDIKNGKEIAMVDYDKEKQTFDLKNVDLSKYDEVTIYCKKAHVIFGGAKLK

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Lipoprotein [1] [2] [3] [4]
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: SaeR (activation) regulon
    SaeR(TF)important in Virulence; RegPrecise 

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: 12.78 h [5]

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]