From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0771 [new locus tag: SA_RS04405 ]
  • pan locus tag?: SAUPAN002840000
  • symbol: SA0771
  • pan gene symbol?: metQ1
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0771 [new locus tag: SA_RS04405 ]
  • symbol: SA0771
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 877329..878150
  • length: 822
  • essential: yes DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAAAAAATTATTTGGTCTTATTTTAGTATTAACATTTGCAGTTGTATTAGCAGCTTGC
    GGTAATGGAAACAAAAGTGGCAGTGACGATAAGAAAATAACAGTAGGTGCTTCACCAGCA
    CCACATGCTGAAATTTTAGAAAAAGCAAAACCATTATTAGAGAAAAAAGGTTATGACCTA
    GATATTAAAACAATTAACGATTACACTACGCCTAATAAATTACTAGATAAAGGTGAAATT
    GACGCAAACTATTTCCAACATACACCATATTTAAACACAGAGAAAAAGGATAAAGGTTAC
    AAAATCGTAAGTGCCGGTGATGTTCACTTAGAACCTATGGCTGTATACTCTAAAAAGTAT
    AAAAGTTTAAAAGAATTACCAAAAGGTGCGACAGTTTATGTGTCTAATAATCCAGCTGAA
    CAAGGACGCTTCTTAAAATTCTTCGTTGATGCAGGTTTAATTAAGATCAAAAAAGGCGTA
    AAAATTGAAGATGCTAAGTTTAGTGATATTACAGAGAATAAAAAAGATATTAAGTTTAAT
    AATAAACAATCAGCAGAATTCTTACCTAAAATTTATCAAAATGAAGACGCTGATGCTGTT
    ATCATTAATTCAAACTTTGCAATCGAACAAAAACTAAATCCTAAAAAAGATTCTATTGCT
    GTAGAAAGTGCGAAAGATAATCCTTATGCAAACTTAATTGCTGTTAAAGAAGGACATCAA
    GATGATAAGAAAATCAAAGCATTAATTGAAGTATTACAATCTAAAGATATTCAAGACTTC
    ATTAATGAAAAATACAACGGTGCAGTTATTCCTGCTAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    822

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA0771 [new locus tag: SA_RS04405 ]
  • symbol: SA0771
  • description: hypothetical protein
  • length: 273
  • theoretical pI: 9.49386
  • theoretical MW: 30336.7
  • GRAVY: -0.484615

Function[edit | edit source]

  • TIGRFAM:
    Cell structure Cell envelope Other lipoprotein, YaeC family (TIGR00363; HMM-score: 168.9)
  • TheSEED:  
    Amino Acids and Derivatives Lysine, threonine, methionine, and cysteine Methionine Biosynthesis  Methionine ABC transporter substrate-binding protein
    and 2 more
    Methionine Degradation  Methionine ABC transporter substrate-binding protein
    Phages, Prophages, Transposable elements, Plasmids Pathogenicity islands Staphylococcal pathogenicity islands SaPI  Methionine ABC transporter substrate-binding protein
  • PFAM:
    PBP (CL0177) Lipoprotein_9; NLPA lipoprotein (PF03180; HMM-score: 291.5)
    and 2 more
    OpuAC; Substrate binding domain of ABC-type glycine betaine transport system (PF04069; HMM-score: 18.6)
    Phosphonate-bd; ABC transporter, phosphonate, periplasmic substrate-binding protein (PF12974; HMM-score: 16.1)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.68
    • Cellwall Score: 0.17
    • Extracellular Score: 0.16
    • Internal Helix: 1
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: -0.33
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: VVLAACG
  • SignalP: Signal peptide LIPO(Sec/SPII) length 19 aa
    • SP(Sec/SPI): 0.000469
    • TAT(Tat/SPI): 0.000066
    • LIPO(Sec/SPII): 0.999323
    • Cleavage Site: CS pos: 19-20. LAA-CG. Pr: 0.9998
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKKLFGLILVLTFAVVLAACGNGNKSGSDDKKITVGASPAPHAEILEKAKPLLEKKGYDLDIKTINDYTTPNKLLDKGEIDANYFQHTPYLNTEKKDKGYKIVSAGDVHLEPMAVYSKKYKSLKELPKGATVYVSNNPAEQGRFLKFFVDAGLIKIKKGVKIEDAKFSDITENKKDIKFNNKQSAEFLPKIYQNEDADAVIINSNFAIEQKLNPKKDSIAVESAKDNPYANLIAVKEGHQDDKKIKALIEVLQSKDIQDFINEKYNGAVIPAK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulators: S-box (transcription termination) regulon, CodY (repression) regulon
    S-box(RNA)important in Methionine biosynthesis; RegPrecise  
    CodY(TF)important in Amino acid metabolism; RegPrecise  

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]