From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1113 [new locus tag: SA_RS06300 ]
  • pan locus tag?: SAUPAN003571000
  • symbol: rbfA
  • pan gene symbol?: rbfA
  • synonym:
  • product: ribosome-binding factor A

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1113 [new locus tag: SA_RS06300 ]
  • symbol: rbfA
  • product: ribosome-binding factor A
  • replicon: chromosome
  • strand: +
  • coordinates: 1263268..1263618
  • length: 351
  • essential: yes DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAGCAGTATGAGAGCAGAGCGTGTTGGTGAACAAATGAAGAAGGAATTAATGGATATC
    ATCAACAATAAAGTCAAAGATCCTCGAGTTGGTTTTATTACAATTACAGATGTTGTTTTA
    ACAAATGATTTATCGCAGGCTAAAGTATTTTTAACTGTATTAGGTAACGATAAAGAAGTA
    GAAAATACATTTAAAGCACTTGATAAAGCAAAAGGCTTCATTAAGTCTGAATTAGGTTCT
    AGAATGCGATTACGTATTATGCCGGAATTAATGTATGAATATGATCAATCAATCGAATAT
    GGTAATAAAATTGAACGAATGATTCAAGATTTACACAAACAAGATAGATAA
    60
    120
    180
    240
    300
    351

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1113 [new locus tag: SA_RS06300 ]
  • symbol: RbfA
  • description: ribosome-binding factor A
  • length: 116
  • theoretical pI: 8.907
  • theoretical MW: 13514.6
  • GRAVY: -0.543966

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Transcription RNA processing ribosome-binding factor A (TIGR00082; HMM-score: 126)
  • TheSEED  :
    • Ribosome-binding factor A
    Protein Metabolism Protein biosynthesis Translation initiation factors bacterial  Ribosome-binding factor A
    and 1 more
    RNA Metabolism RNA processing and modification RNA processing and degradation, bacterial  Ribosome-binding factor A
  • PFAM:
    DnaA_N (CL0494) RBFA; Ribosome-binding factor A (PF02033; HMM-score: 111.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004485
    • TAT(Tat/SPI): 0.000119
    • LIPO(Sec/SPII): 0.000266
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSSMRAERVGEQMKKELMDIINNKVKDPRVGFITITDVVLTNDLSQAKVFLTVLGNDKEVENTFKALDKAKGFIKSELGSRMRLRIMPELMYEYDQSIEYGNKIERMIQDLHKQDR

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]