Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS06300 [old locus tag: SA1113 ]
- pan locus tag?: SAUPAN003571000
- symbol: SA_RS06300
- pan gene symbol?: rbfA
- synonym:
- product: ribosome-binding factor A
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS06300 [old locus tag: SA1113 ]
- symbol: SA_RS06300
- product: ribosome-binding factor A
- replicon: chromosome
- strand: +
- coordinates: 1263268..1263618
- length: 351
- essential: yes DEG other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAGCAGTATGAGAGCAGAGCGTGTTGGTGAACAAATGAAGAAGGAATTAATGGATATC
ATCAACAATAAAGTCAAAGATCCTCGAGTTGGTTTTATTACAATTACAGATGTTGTTTTA
ACAAATGATTTATCGCAGGCTAAAGTATTTTTAACTGTATTAGGTAACGATAAAGAAGTA
GAAAATACATTTAAAGCACTTGATAAAGCAAAAGGCTTCATTAAGTCTGAATTAGGTTCT
AGAATGCGATTACGTATTATGCCGGAATTAATGTATGAATATGATCAATCAATCGAATAT
GGTAATAAAATTGAACGAATGATTCAAGATTTACACAAACAAGATAGATAA60
120
180
240
300
351
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS06300 [old locus tag: SA1113 ]
- symbol: SA_RS06300
- description: ribosome-binding factor A
- length: 116
- theoretical pI: 8.907
- theoretical MW: 13514.6
- GRAVY: -0.543966
⊟Function[edit | edit source]
- TIGRFAM: Transcription RNA processing ribosome-binding factor A (TIGR00082; HMM-score: 126)
- TheSEED: see SA1113
- PFAM: DnaA_N (CL0494) RBFA; Ribosome-binding factor A (PF02033; HMM-score: 123.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9948
- Cytoplasmic Membrane Score: 0.001
- Cell wall & surface Score: 0
- Extracellular Score: 0.0042
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004485
- TAT(Tat/SPI): 0.000119
- LIPO(Sec/SPII): 0.000266
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSSMRAERVGEQMKKELMDIINNKVKDPRVGFITITDVVLTNDLSQAKVFLTVLGNDKEVENTFKALDKAKGFIKSELGSRMRLRIMPELMYEYDQSIEYGNKIERMIQDLHKQDR
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]