From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1222
  • pan locus tag?: SAUPAN003802000
  • symbol: truncated-SA
  • pan gene symbol?:
  • synonym:
  • product: transposase

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1222
  • symbol: truncated-SA
  • product: transposase
  • replicon: chromosome
  • strand: +
  • coordinates: 1395599..1395895
  • length: 297
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    TTGAAATACATTAAAGCCCAAATTAATCAAAAGCTTTCTGAACCAGAAACGAAAAAAATC
    TATAGTCATAGAAAAATTTATGTAGAGCCTGTTTTTGGATTTATGAAGGTTATTTTGGGT
    TTCACTCGAATGTCAGTTCGAGGAATAAATAAAGTTAAACGAGAGCTAGGTTTTGTATTA
    ATGGCACTTAATATAAGGAAAATAGCAGCTCAACGAGCTGTACATTATAAAATACATATC
    AAAAAAGCTAATTTCCATCAAATAATTAATAGAAATCAGCTTTTTTACATTGCCTAA
    60
    120
    180
    240
    297


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1222
  • symbol: Truncated-SA
  • description: transposase
  • length: 98
  • theoretical pI: 11.3009
  • theoretical MW: 11618.9
  • GRAVY: -0.152041

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Mobile element protein
  • PFAM:
    RNase_H (CL0219) DDE_Tnp_1_6; Transposase DDE domain (PF13751; HMM-score: 48)
    and 3 more
    DDE_Tnp_1; Transposase DDE domain (PF01609; HMM-score: 33.6)
    no clan defined DUF6168; Family of unknown function (DUF6168) (PF19665; HMM-score: 15.8)
    DUF3098; Protein of unknown function (DUF3098) (PF11297; HMM-score: 12.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8924
    • Cytoplasmic Membrane Score: 0.0013
    • Cell wall & surface Score: 0.0017
    • Extracellular Score: 0.1046
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.013728
    • TAT(Tat/SPI): 0.000477
    • LIPO(Sec/SPII): 0.001216
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 15926970 NCBI
  • RefSeq: NP_374503 NCBI
  • UniProt:

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKYIKAQINQKLSEPETKKIYSHRKIYVEPVFGFMKVILGFTRMSVRGINKVKRELGFVLMALNIRKIAAQRAVHYKIHIKKANFHQIINRNQLFYIA

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]