Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1301 [new locus tag: NWMN_RS15330 ]
- pan locus tag?: SAUPAN003802000
- symbol: NWMN_1301
- pan gene symbol?: —
- synonym:
- product: putative transposase for IS1272
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1301 [new locus tag: NWMN_RS15330 ]
- symbol: NWMN_1301
- product: putative transposase for IS1272
- replicon: chromosome
- strand: +
- coordinates: 1432841..1433137
- length: 297
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5332296 NCBI
- RefSeq: YP_001332335 NCBI
- BioCyc:
- MicrobesOnline: 3706853 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241TTGAAATACATTAAAGCCCAAATTAATCAAAAGCTTTCTGAACCAGAAACGAAAAAAATC
TATAGTCATAGAAAAATTTATGTAGAGCCTGTTTTTGGATTTATGAAGGCTATTTTGGGT
TTCACTCGAATGTCAGTTCGAGGAATAAATAAAGTTAAACGAGAGCTAGGTTTTGTATTA
ATGGCACTTAATATAAGGAAAATAGCAGCTCAACGAGCTGTACATTATAAAATACATATC
AAAAAAGCTGATTTCCATCAAATAATTAATAGAAATCAGCTTTTTTACATTGCCTAA60
120
180
240
297
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1301 [new locus tag: NWMN_RS15330 ]
- symbol: NWMN_1301
- description: putative transposase for IS1272
- length: 98
- theoretical pI: 11.1661
- theoretical MW: 11591.8
- GRAVY: -0.176531
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Mobile element protein
- PFAM: RNase_H (CL0219) DDE_Tnp_1_6; Transposase DDE domain (PF13751; HMM-score: 47.8)and 1 moreDDE_Tnp_1; Transposase DDE domain (PF01609; HMM-score: 35.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8952
- Cytoplasmic Membrane Score: 0.0014
- Cell wall & surface Score: 0.0015
- Extracellular Score: 0.1019
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.012832
- TAT(Tat/SPI): 0.000595
- LIPO(Sec/SPII): 0.001468
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKYIKAQINQKLSEPETKKIYSHRKIYVEPVFGFMKAILGFTRMSVRGINKVKRELGFVLMALNIRKIAAQRAVHYKIHIKKADFHQIINRNQLFYIA
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]