From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1657 [new locus tag: SA_RS09365 ]
  • pan locus tag?: SAUPAN004764000
  • symbol: SA1657
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1657 [new locus tag: SA_RS09365 ]
  • symbol: SA1657
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1890856..1891221
  • length: 366
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAGCATCACGCATTCTATTCGGTATCGGTGTTGGCGTAGCAGCTGGTTTTGTAGTT
    GCACTTCAAGGACGAGACGACAAAAGTGTCAAGAACAACACGATCGATCGTACTGCCCCT
    ACTGGTTCAAAATCAGAACTACAACGTGAATTTGAAACGATTAAACAAAGTTTTAATGAC
    ATTTTAAACTATGGTGTTCAAATTAAAAACGAAAGTGCGGAATTTGGTAGTTCAATTGGT
    GGTGAAATTAAGTCATTACTTGGAAACTTCAAATCTGACATTAATCCTAATATTGAACGT
    TTACAGTCACACATCGAAAATTTACAAAATCGTGGCGAGGATATTGGAAACGAAATTTCT
    AAGTAG
    60
    120
    180
    240
    300
    360
    366


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1657 [new locus tag: SA_RS09365 ]
  • symbol: SA1657
  • description: hypothetical protein
  • length: 121
  • theoretical pI: 5.92008
  • theoretical MW: 13211.7
  • GRAVY: -0.490083

Function[edit | edit source]

  • TIGRFAM:
    two transmembrane protein (TIGR04527; HMM-score: 16.3)
  • TheSEED  :
    • Hypothetical protein SAV1839
    Membrane Transport Protein translocation across cytoplasmic membrane EcsAB transporter affecting expression and secretion of secretory preproteins  Hypothetical protein SAV1839
  • PFAM:
    no clan defined YicC-like_C; Endoribonuclease YicC-like, C-terminal (PF08340; HMM-score: 17.7)
    Baculo_PEP_C; Baculovirus polyhedron envelope protein, PEP, C terminus (PF04513; HMM-score: 15)
    and 3 more
    FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 13.2)
    Lectin_N; Hepatic lectin, N-terminal domain (PF03954; HMM-score: 13)
    Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 12.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0204
    • Cytoplasmic Membrane Score: 0.7761
    • Cell wall & surface Score: 0.0351
    • Extracellular Score: 0.1684
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: GFVVALQG
  • SignalP: Signal peptide LIPO(Sec/SPII) length 24 aa
    • SP(Sec/SPI): 0.285764
    • TAT(Tat/SPI): 0.011934
    • LIPO(Sec/SPII): 0.562317
    • Cleavage Site: CS pos: 24-25. LQG-RD. Pr: 0.3957
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKASRILFGIGVGVAAGFVVALQGRDDKSVKNNTIDRTAPTGSKSELQREFETIKQSFNDILNYGVQIKNESAEFGSSIGGEIKSLLGNFKSDINPNIERLQSHIENLQNRGEDIGNEISK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]