From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1895 [new locus tag: SACOL_RS09760 ]
  • pan locus tag?: SAUPAN004764000
  • symbol: SACOL1895
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1895 [new locus tag: SACOL_RS09760 ]
  • symbol: SACOL1895
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1949051..1949416
  • length: 366
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAGCATCACGCATTCTATTCGGTATCGGTGTTGGCGTAGCAGCTGGTTTTGTAGTT
    GCACTTCAAGGACGTGACGACAAAAGTGTCAAGAACAACACGATCGATCGTACTGCCCCT
    ACTGGTTCAAAATCAGAACTACAACGTGAATTTGAAACGATTAAACAAAGTTTTAATGAC
    ATTTTAAACTATGGTGTTCAAATTAAAAACGAAAGTGCGGAATTTGGTAGTTCAATTGGT
    GGTGAAATTAAGTCATTACTTGGAAACTTCAAATCTGACATTAATCCTAATATTGAACGT
    TTACAGTCACACATCGAAAATTTACAAAATCGTGGCGAGGATATTGGAAACGAAATTTCT
    AAGTAG
    60
    120
    180
    240
    300
    360
    366

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1895 [new locus tag: SACOL_RS09760 ]
  • symbol: SACOL1895
  • description: hypothetical protein
  • length: 121
  • theoretical pI: 5.92008
  • theoretical MW: 13211.7
  • GRAVY: -0.490083

⊟Function[edit | edit source]

  • TIGRFAM:
    two transmembrane protein (TIGR04527; HMM-score: 16.3)
  • TheSEED  :
    • Hypothetical protein SAV1839
    Membrane Transport Protein translocation across cytoplasmic membrane EcsAB transporter affecting expression and secretion of secretory preproteins  Hypothetical protein SAV1839
  • PFAM:
    no clan defined DUF1732; Domain of unknown function (DUF1732) (PF08340; HMM-score: 17.9)
    Baculo_PEP_C; Baculovirus polyhedron envelope protein, PEP, C terminus (PF04513; HMM-score: 14.9)
    Lectin_N; Hepatic lectin, N-terminal domain (PF03954; HMM-score: 14.7)
    and 2 more
    Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 13.3)
    YtxH; YtxH-like protein (PF12732; HMM-score: 8.3)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: GFVVALQG
  • SignalP: Signal peptide LIPO(Sec/SPII) length 24 aa
    • SP(Sec/SPI): 0.285764
    • TAT(Tat/SPI): 0.011934
    • LIPO(Sec/SPII): 0.562317
    • Cleavage Site: CS pos: 24-25. LQG-RD. Pr: 0.3957
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKASRILFGIGVGVAAGFVVALQGRDDKSVKNNTIDRTAPTGSKSELQREFETIKQSFNDILNYGVQIKNESAEFGSSIGGEIKSLLGNFKSDINPNIERLQSHIENLQNRGEDIGNEISK

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Signal peptide containing [1] [2] [3]
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: SigB* (activation) regulon
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [4]   other strains

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: 9.1 h [5]

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  5. ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SACOL1895&oldid=91710"