Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_001837
- pan locus tag?: SAUPAN004764000
- symbol: JSNZ_001837
- pan gene symbol?: —
- synonym:
- product: YtxH domain-containing protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_001837
- symbol: JSNZ_001837
- product: YtxH domain-containing protein
- replicon: chromosome
- strand: +
- coordinates: 1874138..1874503
- length: 366
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAAAGCATCACGCATTCTATTCGGTATCGGTGTTGGTGTAGCAGCTGGTTTTGTAGTT
GCACTTCAAGGACGAGACGACAAAAGTGTCAAGAACAACACGATCGATCGTACTGCCCCT
ACTGGTTCAAAATCAGAACTACAACGTGAATTTGAAACGATTAAACAAAGTTTTAATGAC
ATTTTAAACTATGGTGTTCAAATTAAAAACGAAAGTGCGGAATTTGGTAGTTCAATTGGT
GGTGAAATTAAGTCATTACTTGGAAACTTCAAATCTGACATCAATCCTAATATTGAACGT
TTACAGTCACACATCGAAAATTTACAAAATCGTGGCGAGGATATTGGAAACGAAATTTCT
AAGTAG60
120
180
240
300
360
366
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_001837
- symbol: JSNZ_001837
- description: YtxH domain-containing protein
- length: 121
- theoretical pI: 5.92008
- theoretical MW: 13211.7
- GRAVY: -0.490083
⊟Function[edit | edit source]
- TIGRFAM: two transmembrane protein (TIGR04527; HMM-score: 16.3)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined YicC-like_C; Endoribonuclease YicC-like, C-terminal (PF08340; HMM-score: 17.7)Baculo_PEP_C; Baculovirus polyhedron envelope protein, PEP, C terminus (PF04513; HMM-score: 15)and 3 moreFlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 13.2)Lectin_N; Hepatic lectin, N-terminal domain (PF03954; HMM-score: 13)Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 12.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0204
- Cytoplasmic Membrane Score: 0.7761
- Cell wall & surface Score: 0.0351
- Extracellular Score: 0.1684
- LocateP:
- SignalP: Signal peptide LIPO(Sec/SPII) length 24 aa
- SP(Sec/SPI): 0.285764
- TAT(Tat/SPI): 0.011934
- LIPO(Sec/SPII): 0.562317
- Cleavage Site: CS pos: 24-25. LQG-RD. Pr: 0.3957
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MKASRILFGIGVGVAAGFVVALQGRDDKSVKNNTIDRTAPTGSKSELQREFETIKQSFNDILNYGVQIKNESAEFGSSIGGEIKSLLGNFKSDINPNIERLQSHIENLQNRGEDIGNEISK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SigB (activation) regulon
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p) - ↑ Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
J Bacteriol: 2011, 193(18);4954-62
[PubMed:21725011] [WorldCat.org] [DOI] (I p)