Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1753
- pan locus tag?: SAUPAN005015000
- symbol: SA1753
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1753
- symbol: SA1753
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2005924..2006211
- length: 288
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1124640 NCBI
- RefSeq: NP_375048 NCBI
- BioCyc:
- MicrobesOnline: 104074 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241GTGAAGAACCATACAAATATAATTAATATCTTATTAGTTATAGTCAACTCATTAACTCAT
TTTCTAACTCTAAACACCTCATTTTTTAATAGTTCAGCATCGGATTTCTGTTTTATCATA
GGGGCTATATTTTTCTTGATCGGAATTTTTGTTGCAATATACGGTATGAAGCGAGCAACA
TATTGGTTAAACTTATTGATTTTATTTACCAATATTTTTTATTTTCTACACTTCTGTGTT
TTACTTTTGTTAAAATATATAGGATTTAAATTATTTATTTATTTATGA60
120
180
240
288
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1753
- symbol: SA1753
- description: hypothetical protein
- length: 95
- theoretical pI: 9.53447
- theoretical MW: 11116.4
- GRAVY: 1.27579
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Phage protein
- PFAM: CopD_like (CL0430) YtpI; YtpI-like protein (PF14007; HMM-score: 19.1)no clan defined DUF202; Domain of unknown function (DUF202) (PF02656; HMM-score: 17)and 2 moreTSPAN_4TM-like (CL0347) CD20; CD20-like family (PF04103; HMM-score: 12.6)Tetraspanin; Tetraspanin family (PF00335; HMM-score: 9.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0002
- Cytoplasmic Membrane Score: 0.9844
- Cell wall & surface Score: 0
- Extracellular Score: 0.0154
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.037513
- TAT(Tat/SPI): 0.0005
- LIPO(Sec/SPII): 0.048137
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKNHTNIINILLVIVNSLTHFLTLNTSFFNSSASDFCFIIGAIFFLIGIFVAIYGMKRATYWLNLLILFTNIFYFLHFCVLLLLKYIGFKLFIYL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]