From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

Summary[edit | edit source]

  • pan ID?: SAUPAN005015000
  • symbol?:
  • description?: phage protein
  • strand?: +
  • coordinates?: 5191993..5192301
  • synteny block?: BlockID0038960
  • occurrence?: in 42% of 33 strains

Orthologs[edit | edit source]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1899
    08BA02176:
    11819-97:
    6850:
    71193:
    ST398NM01_2911
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_18560
    JH1:
    SaurJH1_2032
    JH9:
    SaurJH9_1998
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR2033
    MSHR1132:
    MSSA476:
    SAS1864
    Mu3:
    SAHV_1926
    Mu50:
    SAV1941
    MW2:
    MW1883
    RF122:
    ST398:
    T0131:
    TCH60:
    HMPREF0772_11201
    TW20:
    SATW20_19340
    USA300_TCH1516:
    VC40:

Genome Viewer[edit | edit source]

N315
Newman

Alignments[edit | edit source]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.307)


    N315            MKNHTNIINILLVIVNSLTHFLTLNTSFFNSSASDFCFIIGAIFFLIGIFVAIYGMKRAT
    Newman          MKNHTNIINILLVIVNSLTHFLTLNTSFFNNSASDFCFIIGAIFFLIGIFVAIYGMKRAT
                    ******************************.*****************************

    N315            YWLNLLILFTNIFYFLHFCVLLLLKYIGFKLFIY-------L
    Newman          YWLNLLILFTNIFYFLHFCVLLLLKYIGFKLFIYEGCVLLFT
                    **********************************