Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1860 [new locus tag: SA_RS10680 ]
- pan locus tag?: SAUPAN005305000
- symbol: SA1860
- pan gene symbol?: ilvH
- synonym:
- product: acetolactate synthase 1 regulatory subunit
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1860 [new locus tag: SA_RS10680 ]
- symbol: SA1860
- product: acetolactate synthase 1 regulatory subunit
- replicon: chromosome
- strand: +
- coordinates: 2101077..2101331
- length: 255
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124754 NCBI
- RefSeq: NP_375163 NCBI
- BioCyc:
- MicrobesOnline: 104189 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGACAAGAATTCTTAAATTACAAGTTGCGGATCAAGTCAGCACGCTAAATCGAATTACA
AGTGCTTTTGTTCGCCTACAATATAATATCGATACATTACATGTTACACATTCTGAACAA
CCTGGGATTTCTAACATGGAAATTCAAGTCGATATTCAAGATGATACATCACTTCATATA
TTAATTAAAAAATTAAAACAACAAATTAATGTTTTAACGGTTGAATGCTACGACCTTGTT
GATAACGAAGCTTAA60
120
180
240
255
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1860 [new locus tag: SA_RS10680 ]
- symbol: SA1860
- description: acetolactate synthase 1 regulatory subunit
- length: 84
- theoretical pI: 4.96128
- theoretical MW: 9620.96
- GRAVY: -0.114286
⊟Function[edit | edit source]
- TIGRFAM: Amino acid biosynthesis Pyruvate family acetolactate synthase, small subunit (TIGR00119; EC 2.2.1.6; HMM-score: 48)and 4 moreCellular processes Adaptations to atypical conditions RelA/SpoT family protein (TIGR00691; HMM-score: 19.3)Amino acid biosynthesis Serine family phosphoglycerate dehydrogenase (TIGR01327; EC 1.1.1.95; HMM-score: 14.2)Energy metabolism Amino acids and amines L-serine dehydratase, iron-sulfur-dependent, beta subunit (TIGR00719; EC 4.3.1.17; HMM-score: 12.9)Energy metabolism Glycolysis/gluconeogenesis L-serine dehydratase, iron-sulfur-dependent, beta subunit (TIGR00719; EC 4.3.1.17; HMM-score: 12.9)
- TheSEED :
- Acetolactate synthase small subunit (EC 2.2.1.6)
Amino Acids and Derivatives Branched-chain amino acids Branched-Chain Amino Acid Biosynthesis Acetolactate synthase small subunit (EC 2.2.1.6)and 1 more - PFAM: ACT (CL0070) ACT_4; ACT domain (PF13291; HMM-score: 30.9)ACT_5; ACT domain (PF13710; HMM-score: 28.7)ACT; ACT domain (PF01842; HMM-score: 25.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002856
- TAT(Tat/SPI): 0.000349
- LIPO(Sec/SPII): 0.00056
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTRILKLQVADQVSTLNRITSAFVRLQYNIDTLHVTHSEQPGISNMEIQVDIQDDTSLHILIKKLKQQINVLTVECYDLVDNEA
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: CodY (repression) regulon
CodY (TF) important in Amino acid metabolism; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Charlotte D Majerczyk, Paul M Dunman, Thanh T Luong, Chia Y Lee, Marat R Sadykov, Greg A Somerville, Kip Bodi, Abraham L Sonenshein
Direct targets of CodY in Staphylococcus aureus.
J Bacteriol: 2010, 192(11);2861-77
[PubMed:20363936] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]