From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2008 [new locus tag: SAUSA300_RS11045 ]
  • pan locus tag?: SAUPAN005305000
  • symbol: ilvN
  • pan gene symbol?: ilvH
  • synonym:
  • product: acetolactate synthase 1 regulatory subunit

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2008 [new locus tag: SAUSA300_RS11045 ]
  • symbol: ilvN
  • product: acetolactate synthase 1 regulatory subunit
  • replicon: chromosome
  • strand: +
  • coordinates: 2168358..2168612
  • length: 255
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGACAAGAATTCTTAAATTACAAGTTGCGGATCAAGTCAGCACGCTAAATCGAATTACA
    AGTGCTTTTGTTCGCCTACAATATAATATCGATACATTACATGTTACACATTCTGAACAA
    CCTGGGATTTCTAACATGGAAATTCAAGTCGATATTCAAGATGATACATCACTTCATATA
    TTAATTAAAAAATTAAAACAACAAATTAATGTTTTAACGGTTGAATGCTACGACCTTGTT
    GATAACGAAGCTTAA
    60
    120
    180
    240
    255

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_2008 [new locus tag: SAUSA300_RS11045 ]
  • symbol: IlvN
  • description: acetolactate synthase 1 regulatory subunit
  • length: 84
  • theoretical pI: 4.96128
  • theoretical MW: 9620.96
  • GRAVY: -0.114286

⊟Function[edit | edit source]

  • reaction:
    EC 2.2.1.6?  ExPASy
    Acetolactate synthase 2 pyruvate = 2-acetolactate + CO2
  • TIGRFAM:
    Metabolism Amino acid biosynthesis Pyruvate family acetolactate synthase, small subunit (TIGR00119; EC 2.2.1.6; HMM-score: 48)
    and 4 more
    Cellular processes Cellular processes Adaptations to atypical conditions RelA/SpoT family protein (TIGR00691; HMM-score: 19.3)
    Metabolism Amino acid biosynthesis Serine family phosphoglycerate dehydrogenase (TIGR01327; EC 1.1.1.95; HMM-score: 14.2)
    Metabolism Energy metabolism Amino acids and amines L-serine dehydratase, iron-sulfur-dependent, beta subunit (TIGR00719; EC 4.3.1.17; HMM-score: 12.9)
    Metabolism Energy metabolism Glycolysis/gluconeogenesis L-serine dehydratase, iron-sulfur-dependent, beta subunit (TIGR00719; EC 4.3.1.17; HMM-score: 12.9)
  • TheSEED  :
    • Acetolactate synthase small subunit (EC 2.2.1.6)
    Amino Acids and Derivatives Branched-chain amino acids Branched-Chain Amino Acid Biosynthesis  Acetolactate synthase small subunit (EC 2.2.1.6)
    and 1 more
    Carbohydrates Fermentation Acetoin, butanediol metabolism  Acetolactate synthase small subunit (EC 2.2.1.6)
  • PFAM:
    ACT (CL0070) ACT_4; ACT domain (PF13291; HMM-score: 30.9)
    ACT_5; ACT domain (PF13710; HMM-score: 28.7)
    ACT; ACT domain (PF01842; HMM-score: 25.7)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002856
    • TAT(Tat/SPI): 0.000349
    • LIPO(Sec/SPII): 0.00056
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MTRILKLQVADQVSTLNRITSAFVRLQYNIDTLHVTHSEQPGISNMEIQVDIQDDTSLHILIKKLKQQINVLTVECYDLVDNEA

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: CodY (repression) regulon
    CodY(TF)important in Amino acid metabolism; RegPrecise    transcription unit transferred from N315 data RegPrecise 

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Charlotte D Majerczyk, Paul M Dunman, Thanh T Luong, Chia Y Lee, Marat R Sadykov, Greg A Somerville, Kip Bodi, Abraham L Sonenshein
    Direct targets of CodY in Staphylococcus aureus.
    J Bacteriol: 2010, 192(11);2861-77
    [PubMed:20363936] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_2008&oldid=74219"