Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1909 [new locus tag: SA_RS10985 ]
- pan locus tag?: SAUPAN005398000
- symbol: atpF
- pan gene symbol?: atpF
- synonym:
- product: ATP synthase F0F1 subunit B
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1909 [new locus tag: SA_RS10985 ]
- symbol: atpF
- product: ATP synthase F0F1 subunit B
- replicon: chromosome
- strand: -
- coordinates: 2159999..2160520
- length: 522
- essential: yes [1] DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124810 NCBI
- RefSeq: NP_375214 NCBI
- BioCyc: see SA_RS10985
- MicrobesOnline: 104240 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481GTGACTGAAACAGCTAACTTATTCGTTCTTGGTGCAGCTGGAGGCGTTGAGTGGGGTACT
GTGATTGTACAGGTCCTAACTTTCATCGTGTTACTTGCGTTACTTAAAAAGTTCGCATGG
GGTCCATTGAAAGATGTAATGGATAAACGTGAAAGAGATATTAACAGAGATATCGATGAC
GCAGAACAAGCTAAGTTAAATGCACAGAAACTTGAAGAAGAAAATAAACAAAAACTTAAA
GAAACACAAGAAGAAGTTCAAAAGATTTTAGAAGATGCTAAGGTTCAAGCACGTCAACAG
CAAGAACAAATTATTCATGAAGCAAACGTACGTGCAAACGGTATGATTGAAACAGCACAA
AGTGAAATCAATAGCCAAAAAGAACGTGCCATTGCAGATATTAATAATCAAGTATCTGAA
CTATCAGTGTTAATTGCTTCTAAAGTTCTTAGAAAAGAAATTTCTGAACAAGACCAAAAA
GCATTGGTTGACAAGTATCTAAAAGAGGCAGGCGATAAATAA60
120
180
240
300
360
420
480
522
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1909 [new locus tag: SA_RS10985 ]
- symbol: AtpF
- description: ATP synthase F0F1 subunit B
- length: 173
- theoretical pI: 4.75697
- theoretical MW: 19539.1
- GRAVY: -0.514451
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism ATP-proton motive force interconversion ATP synthase F0, B subunit (TIGR01144; EC 3.6.3.14; HMM-score: 124.4)and 7 morealternate F1F0 ATPase, F0 subunit B (TIGR03321; EC 3.6.3.-; HMM-score: 76)hydroxylamine oxidation protein HaoB (TIGR04392; HMM-score: 13.5)ATP synthase archaeal, H subunit (TIGR02926; EC 3.6.3.14; HMM-score: 12.4)Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 7.3)two transmembrane protein (TIGR04527; HMM-score: 7)alternate F1F0 ATPase, F1 subunit alpha (TIGR03324; EC 3.6.3.-; HMM-score: 6.2)Transport and binding proteins Cations and iron carrying compounds sodium/hydrogen antiporter (TIGR00844; HMM-score: 4.8)
- TheSEED :
- ATP synthase F0 sector subunit b (EC 7.1.2.2)
- PFAM: ATP_synthase (CL0255) ATP-synt_B; ATP synthase B/B' CF(0) (PF00430; HMM-score: 107.3)and 9 moreMt_ATP-synt_B; Mitochondrial ATP synthase B chain precursor (ATP-synt_B) (PF05405; HMM-score: 22)GT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 18.2)no clan defined DivIVA; DivIVA protein (PF05103; HMM-score: 14.3)FAM222A; Protein family of FAM222A (PF15258; HMM-score: 13.5)RapA_C; RNA polymerase recycling family C-terminal (PF12137; HMM-score: 10.2)Piezo_TM1-24; Piezo TM1-24 (PF24871; HMM-score: 8.7)Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 8.4)no clan defined YfcL; YfcL protein (PF08891; HMM-score: 8.3)UBA (CL0214) HBS1_N; HBS1 N-terminus (PF08938; HMM-score: 8.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9981
- Cell wall & surface Score: 0
- Extracellular Score: 0.0019
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 4
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005976
- TAT(Tat/SPI): 0.00052
- LIPO(Sec/SPII): 0.002479
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTETANLFVLGAAGGVEWGTVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDDAEQAKLNAQKLEEENKQKLKETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVSELSVLIASKVLRKEISEQDQKALVDKYLKEAGDK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
Mol Microbiol: 2002, 43(6);1387-400
[PubMed:11952893] [WorldCat.org] [DOI] (P p)