Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2154 [new locus tag: SA_RS12370 ]
- pan locus tag?: SAUPAN005873000
- symbol: SA2154
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2154 [new locus tag: SA_RS12370 ]
- symbol: SA2154
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2419557..2420012
- length: 456
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1125082 NCBI
- RefSeq: NP_375477 NCBI
- BioCyc: see SA_RS12370
- MicrobesOnline: 104503 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAAAAATTTGAAAAACTCATTATTTATTAGCTTAATCATTGGTTTGTCCCTTTCACTG
TTCTTTAGTATGTTATTTGCAGACGGCAAATATTATCCACTGAACCCACAATCAACTATT
GGCATTTTGTATTATAATCATTTCACAGAAACTACCGTAATGTTGATTTCTATCATTTTA
TGGTTACTCATAGGCGTCGTCTTTTTCCTTGGAGATTTTATCTTTAAATACACAGATTGG
AGCATTACTAAAGCAACTATAATGCATTTCATAACAACGTATGTCGGATTCTTGCCTTTA
GCAATGCTTGCCGGTTGGTTTCCACTAACAGTGCATTATCTAATCATATTCACAATTATC
TTCATTGTGATTTATGTATTAATTTGGATAATTCAATTCTTTAAAAACAAGAACTACGTA
GACACTATTAACGAGCAACTGAAACAATTAAAATGA60
120
180
240
300
360
420
456
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA2154 [new locus tag: SA_RS12370 ]
- symbol: SA2154
- description: hypothetical protein
- length: 151
- theoretical pI: 9.47248
- theoretical MW: 17704.2
- GRAVY: 0.918543
⊟Function[edit | edit source]
- TIGRFAM: Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan stage V sporulation protein D (TIGR02214; HMM-score: 9.4)Cellular processes Sporulation and germination stage V sporulation protein D (TIGR02214; HMM-score: 9.4)Cellular processes Pathogenesis type VI secretion protein IcmF (TIGR03348; HMM-score: 9)
- TheSEED :
- FIG01108202: hypothetical protein
- PFAM: no clan defined DUF3021; Protein of unknown function (DUF3021) (PF11457; HMM-score: 123)and 7 moreDUF4381; Domain of unknown function (DUF4381) (PF14316; HMM-score: 13.6)DUF4271; Domain of unknown function (DUF4271) (PF14093; HMM-score: 12.6)Holin_SPP1; SPP1 phage holin (PF04688; HMM-score: 10.1)DUF6585; Family of unknown function (DUF6585) (PF20226; HMM-score: 9.5)RBG (CL0760) AsmA; AsmA family (PF05170; HMM-score: 8.4)no clan defined Phage_holin_3_6; Putative Actinobacterial Holin-X, holin superfamily III (PF07332; HMM-score: 8.1)Peptidase_MA (CL0126) DUF3810; Protein of unknown function (DUF3810) (PF12725; HMM-score: 7.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0003
- Cytoplasmic Membrane Score: 0.9979
- Cell wall & surface Score: 0
- Extracellular Score: 0.0018
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0
- Signal peptide possibility: 1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.165681
- TAT(Tat/SPI): 0.002333
- LIPO(Sec/SPII): 0.143688
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKNLKNSLFISLIIGLSLSLFFSMLFADGKYYPLNPQSTIGILYYNHFTETTVMLISIILWLLIGVVFFLGDFIFKYTDWSITKATIMHFITTYVGFLPLAMLAGWFPLTVHYLIIFTIIFIVIYVLIWIIQFFKNKNYVDTINEQLKQLK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SA2151 > SA2152 > SA2153 > SA2154
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]