Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2227
- pan locus tag?: SAUPAN005987000
- symbol: SA2227
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2227
- symbol: SA2227
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2499033..2499446
- length: 414
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1125154 NCBI
- RefSeq: NP_375550 NCBI
- BioCyc:
- MicrobesOnline: 104576 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTTAGTTTCATCAATTGCATTACTTATAGCAGCCTTGTTAAACTACATTTTCCCTAAT
GCAATTCAACTATTCATATACGTTACAACGTTATCAACTGTGTTGTTTTTAGTTGTTTGG
GCAATGATTATTGTCGCTTATCTAATGTATTTGAAAAAGCATCCTGAGGCACATAAAAAC
AGTAAATTTAAGTTGATTGGTGGTAAGCCTATTGCTTACATTATTCTAGCGTTCTTCTTC
TTTGTATTCATTTTATTATTCTTTAGTGACGAAACAAGAGCAGCTATTTATATTTCACCA
TTCTGGTTTATATTTTTATTTTTCTTTTATAAAAAATACAAAACGAATGCTGAAAAGCTC
GCGTATGAACAACGACAAAATGACAGCGGTCATTTCAGATATGACAATCAATAA60
120
180
240
300
360
414
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA2227
- symbol: SA2227
- description: hypothetical protein
- length: 137
- theoretical pI: 9.9069
- theoretical MW: 16199.2
- GRAVY: 0.641606
⊟Function[edit | edit source]
- TIGRFAM: undecaprenyl-phosphate glucose phosphotransferase (TIGR03023; EC 2.7.8.-; HMM-score: 12.8)Transport and binding proteins Amino acids, peptides and amines GABA permease (TIGR01773; HMM-score: 10.5)Energy metabolism Electron transport cytochrome c oxidase, subunit II (TIGR02866; EC 1.9.3.1; HMM-score: 10.4)and 1 moreexopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 10.2)
- TheSEED :
- D-serine/D-alanine/glycine transporter
Amino Acids and Derivatives Alanine, serine, and glycine Glycine and Serine Utilization D-serine/D-alanine/glycine transporterand 1 more - PFAM: APC (CL0062) AA_permease; Amino acid permease (PF00324; HMM-score: 32)and 10 moreAA_permease_2; Amino acid permease (PF13520; HMM-score: 19.8)no clan defined Oxidored_q3; NADH-ubiquinone/plastoquinone oxidoreductase chain 6 (PF00499; HMM-score: 17.2)Gx_transp (CL0315) ECF_trnsprt; ECF transporter, substrate-specific component (PF12822; HMM-score: 12.3)Transporter (CL0375) Amastin; Amastin surface glycoprotein (PF07344; HMM-score: 10.6)Peroxisome (CL0484) PRT_C; Plant phosphoribosyltransferase C-terminal (PF08372; HMM-score: 8.9)O-anti_assembly (CL0499) Wzy_C; O-Antigen ligase (PF04932; HMM-score: 8.8)no clan defined RAMP4; Ribosome associated membrane protein RAMP4 (PF06624; HMM-score: 8.7)DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 8.6)DHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 7.9)DPM3; Dolichol-phosphate mannosyltransferase subunit 3 (DPM3) (PF08285; HMM-score: 7.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9999
- Cell wall & surface Score: 0
- Extracellular Score: 0.0001
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.000585
- TAT(Tat/SPI): 0.000135
- LIPO(Sec/SPII): 0.006131
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLVSSIALLIAALLNYIFPNAIQLFIYVTTLSTVLFLVVWAMIIVAYLMYLKKHPEAHKNSKFKLIGGKPIAYIILAFFFFVFILLFFSDETRAAIYISPFWFIFLFFFYKKYKTNAEKLAYEQRQNDSGHFRYDNQ
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SA2226 > SA2227 > SA2228
⊟Regulation[edit | edit source]
- regulators: CcpA regulon, CodY (repression) regulon
CcpA (TF) important in Carbon catabolism; RegPrecise CodY (TF) important in Amino acid metabolism; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]