Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0032 [new locus tag: SACOL_RS00180 ]
- pan locus tag?: SAUPAN000100000
- symbol: maoC
- pan gene symbol?: maoC
- synonym:
- product: MaoC domain-containing protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0032 [new locus tag: SACOL_RS00180 ]
- symbol: maoC
- product: MaoC domain-containing protein
- replicon: chromosome
- strand: +
- coordinates: 39169..39597
- length: 429
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236762 NCBI
- RefSeq: YP_184943 NCBI
- BioCyc: see SACOL_RS00180
- MicrobesOnline: 911516 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAAATACGATGATTTTATAGTAGGAGAAACATTCAAAACAAAAAGCCTTCATATTACA
GAAGAAGAAATTATCCAATTTGCAACAACTTTTGATCCTCAATATATGCATATAGATAAA
GAAAAAGCAGAACAAAGTAGATTTAAAGGTATCATTGCATCTGGCATGCATACACTTTCA
ATATCATTTAAATTATGGGTAGAAGAAGGTAAATACGGAGAAGAAGTTGTAGCAGGAACA
CAAATGAATAACGTTAAATTTATTAAACCTGTATACCCAGGTAATACATTGTACGTTATC
GCTGAAATTACAAATAAGAAATCCATAAAAAAAGAAAATGGACTCGTTACAGTGTCACTT
TCAACATACAATGAAAATGAAGAAATTGTATTTAAGGGAGAAGTAACAGCACTTATTAAT
AATTCATAA60
120
180
240
300
360
420
429
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0032 [new locus tag: SACOL_RS00180 ]
- symbol: MaoC
- description: MaoC domain-containing protein
- length: 142
- theoretical pI: 5.2803
- theoretical MW: 16136.3
- GRAVY: -0.311268
⊟Function[edit | edit source]
- TIGRFAM: phenylacetic acid degradation protein paaN (TIGR02278; HMM-score: 60.4)and 1 moreFatty acid and phospholipid metabolism Biosynthesis beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ (TIGR01750; EC 4.2.1.-; HMM-score: 17.9)
- TheSEED :
- MaoC domain protein
- PFAM: HotDog (CL0050) MaoC_dehydratas; MaoC like domain (PF01575; HMM-score: 119.6)and 5 moreFAS1_DH_region; FAS1-like, dehydratase domain region (PF13452; HMM-score: 32.8)MC_hydratase; Mesaconyl-CoA hydratase (PF19315; HMM-score: 16.1)4HBT; Thioesterase superfamily (PF03061; HMM-score: 15.7)FabA; FabA-like domain (PF07977; HMM-score: 15.7)OB (CL0021) OB_YrrC; ATP-dependent DNA helicase YrrC, OB-fold domain (PF23139; HMM-score: 15)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9342
- Cytoplasmic Membrane Score: 0.0501
- Cell wall & surface Score: 0
- Extracellular Score: 0.0158
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002744
- TAT(Tat/SPI): 0.000287
- LIPO(Sec/SPII): 0.00032
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKYDDFIVGETFKTKSLHITEEEIIQFATTFDPQYMHIDKEKAEQSRFKGIIASGMHTLSISFKLWVEEGKYGEEVVAGTQMNNVKFIKPVYPGNTLYVIAEITNKKSIKKENGLVTVSLSTYNENEEIVFKGEVTALINNS
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)