Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0062 [new locus tag: SACOL_RS00320 ]
- pan locus tag?: SAUPAN000488000
- symbol: SACOL0062
- pan gene symbol?: cstR
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0062 [new locus tag: SACOL_RS00320 ]
- symbol: SACOL0062
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 71907..72167
- length: 261
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236883 NCBI
- RefSeq: YP_184967 NCBI
- BioCyc: see SACOL_RS00320
- MicrobesOnline: 911542 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAATTATGATAAAAAAATGATTAATCGTATTAATAGAATACAAGGGCAACTAAATGGA
ATTATTAAAATGATGGAGGAAGGAAAAGACTGTAAAGATGTCATTACACAAATAAGTGCA
TCAAAGAGTTCACTCCAACGCTTGATGGGTATCATTATTAGTGAGAATTTAATAGAATGT
GTAAAAGCAGCTGCGGATGATGAAGAAAGCTCCCAAGAGTTAATTAATGAAGCTGTAAAC
TTATTGGTGAAAAGTAAGTAA60
120
180
240
261
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0062 [new locus tag: SACOL_RS00320 ]
- symbol: SACOL0062
- description: hypothetical protein
- length: 86
- theoretical pI: 5.12449
- theoretical MW: 9641.17
- GRAVY: -0.293023
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG007303: uncharacterized protein
- PFAM: no clan defined Trns_repr_metal; Metal-sensitive transcriptional repressor (PF02583; HMM-score: 88.6)and 4 moreMet_repress (CL0057) Antitox_RHH; Antitoxin-like ribbon-helix-helix (PF20605; HMM-score: 16.7)HTH (CL0123) Dimerisation; Plant O-methyltransferase dimerisation domain (PF08100; HMM-score: 14.2)Met_repress (CL0057) DUF7557; Family of unknown function (DUF7557) (PF24434; HMM-score: 13.7)TPR (CL0020) FANCA_arcN; FANCA arcN subdomain (PF24783; HMM-score: 13.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9383
- Cytoplasmic Membrane Score: 0.0054
- Cell wall & surface Score: 0.0114
- Extracellular Score: 0.0449
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004536
- TAT(Tat/SPI): 0.000986
- LIPO(Sec/SPII): 0.000445
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNYDKKMINRINRIQGQLNGIIKMMEEGKDCKDVITQISASKSSLQRLMGIIISENLIECVKAAADDEESSQELINEAVNLLVKSK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell: 124 [1]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]
Justin L Luebke, Jiangchuan Shen, Kevin E Bruce, Thomas E Kehl-Fie, Hui Peng, Eric P Skaar, David P Giedroc
The CsoR-like sulfurtransferase repressor (CstR) is a persulfide sensor in Staphylococcus aureus.
Mol Microbiol: 2014, 94(6);1343-60
[PubMed:25318663] [WorldCat.org] [DOI] (I p)Jiangchuan Shen, Mary E Keithly, Richard N Armstrong, Khadine A Higgins, Katherine A Edmonds, David P Giedroc
Staphylococcus aureus CstB Is a Novel Multidomain Persulfide Dioxygenase-Sulfurtransferase Involved in Hydrogen Sulfide Detoxification.
Biochemistry: 2015, 54(29);4542-54
[PubMed:26177047] [WorldCat.org] [DOI] (I p)