From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

Summary[edit | edit source]

  • pan ID?: SAUPAN000488000
  • symbol?: cstR
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 523665..524129
  • synteny block?: BlockID0002180
  • occurrence?: in 55% of 33 strains

Orthologs[edit | edit source]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0085
    08BA02176:
    11819-97:
    6850:
    71193:
    ECT-R 2:
    ECTR2_43
    ED133:
    SAOV_0037
    ED98:
    SAAV_0033
    HO 5096 0412:
    JH1:
    SaurJH1_0074
    JH9:
    SaurJH9_0072
    JKD6008:
    JKD6159:
    LGA251:
    SARLGA251_00640
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS0055
    Mu3:
    SAHV_0084
    Mu50:
    SAV0085
    MW2:
    MW0055
    RF122:
    SAB0029c
    ST398:
    T0131:
    TCH60:
    TW20:
    USA300_TCH1516:
    USA300HOU_0091
    VC40:
    SAVC_00140

Genome Viewer[edit | edit source]

COL
N315
NCTC8325
USA300_FPR3757

Alignments[edit | edit source]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.307)


    COL             MNYDKKMINRINRIQGQLNGIIKMMEEGKDCKDVITQISASKSSLQRLMGIIISENLIEC
    N315            MNYDKKMINRINRIQGQLNGIIKMMEEGKDCKDVITQISASKSSLQRLMGIIISENLIEC
    NCTC8325        MNYDKKMINRINRIQGQLNGIIKMMEEGKDCKDVITQISASKSSLQRLMGIIISENLIEC
    USA300_FPR3757  MNYDKKMINRINRIQGQLNGIIKMMEEGKDCKDVITQISASKSSLQRLMGIIISENLIEC
                    ************************************************************

    COL             VKAAADDEESSQELINEAVNLLVKSK
    N315            VKVAADDEESSQELINEAVNLLVKSK
    NCTC8325        VKAAADDEESSQELINEAVNLLVKSK
    USA300_FPR3757  VKAAADDEESSQELINEAVNLLVKSK
                    **.***********************