From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0113 [new locus tag: SACOL_RS00565 ]
  • pan locus tag?: SAUPAN000935000
  • symbol: SACOL0113
  • pan gene symbol?: galE
  • synonym:
  • product: NAD-dependent epimerase/dehydratase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0113 [new locus tag: SACOL_RS00565 ]
  • symbol: SACOL0113
  • product: NAD-dependent epimerase/dehydratase
  • replicon: chromosome
  • strand: +
  • coordinates: 127490..128461
  • length: 972
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    TTGGAAAGAGTTTTGATAACTGGTGGGGCTGGTTTTATTGGGTCGCATTTAGTAGATGAT
    TTACAACAAGATTATGATGTTTATGTTCTAGATAACTATAGAACAGGTAAACGAGAAAAT
    ATTAAAAGTTTGGCTGACGATCATGTGTTTGAATTAGATATTCGTGAATATGATGCAGTT
    GAACAAATCATGAAGACATATCAATTTGATTATGTTATTCATTTAGCAGCATTAGTTAGT
    GTTGCTGAGTCGGTTGAGAAACCTATCTTATCTCAAGAAATAAACGTCGTAGCAACATTA
    AGATTGTTAGAAATCATTAAAAAATATAATAATCATATAAAACGTTTTATCTTTGCTTCG
    TCAGCAGCTGTTTATGGTGATCTTCCTGATTTGCCTAAAAGTGATCAATCATTAATCTTA
    CCATTATCACCATATGCAATAGATAAATATTACGGCGAACGGACGACATTAAATTATTGT
    TCGTTATATAACATACCAACAGCGGTTGTTAAATTTTTTAATGTATTTGGGCCAAGACAG
    GATCCTAAGTCACAATATTCAGGTGTGATTTCAAAGATGTTCGATTCATTTGAGCATAAC
    AAGCCATTTACATTTTTTGGTGACGGACTGCAAACTAGAGATTTTGTATATGTATATGAT
    GTTGTTCAATCTGTACGCTTAATTATGGAACACAAAGATGCAATTGGACACGGTTATAAC
    ATTGGTACAGGCACTTTTACTAATTTATTAGAGGTTTATCGTATTATTGGTGAATTATAT
    GGAAAATCAGTCGAGCATGAATTTAAAGAAGCACGAAAAGGAGATATTAAGCATTCTTAT
    GCAGATATTTCTAACTTAAAGGCATTAGGATTTGTTCCTAAATATACAGTAGAAACAGGT
    TTAAAGGATTACTTTAATTTTGAGGTAGATAATATTGAAGAAGTTACAGCTAAAGAAGTG
    GAAATGTCGTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    972

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0113 [new locus tag: SACOL_RS00565 ]
  • symbol: SACOL0113
  • description: NAD-dependent epimerase/dehydratase
  • length: 323
  • theoretical pI: 5.01028
  • theoretical MW: 36926.6
  • GRAVY: -0.210526

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Sugars UDP-glucose 4-epimerase GalE (TIGR01179; EC 5.1.3.2; HMM-score: 171.3)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides dTDP-glucose 4,6-dehydratase (TIGR01181; EC 4.2.1.46; HMM-score: 170.9)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides ADP-glyceromanno-heptose 6-epimerase (TIGR02197; EC 5.1.3.20; HMM-score: 153.3)
    and 10 more
    NAD dependent epimerase/dehydratase, LLPSF_EDH_00030 family (TIGR04180; HMM-score: 134.4)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides GDP-mannose 4,6-dehydratase (TIGR01472; EC 4.2.1.47; HMM-score: 66)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides CDP-glucose 4,6-dehydratase (TIGR02622; EC 4.2.1.45; HMM-score: 50.2)
    Hypothetical proteins Conserved TIGR01777 family protein (TIGR01777; HMM-score: 48.2)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides dTDP-4-dehydrorhamnose reductase (TIGR01214; EC 1.1.1.133; HMM-score: 46.9)
    hopanoid-associated sugar epimerase (TIGR03466; HMM-score: 45.2)
    thioester reductase domain (TIGR01746; HMM-score: 28.8)
    UDP-N-acetylglucosamine 4,6-dehydratase (inverting) (TIGR03589; EC 4.2.1.115; HMM-score: 20.6)
    UDP-N-acetylglucosamine 4,6-dehydratase/5-epimerase (TIGR04130; EC 4.2.1.-,5.1.3.-; HMM-score: 18.5)
    2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (TIGR04316; EC 1.3.1.28; HMM-score: 12.2)
  • TheSEED:  
    Carbohydrates Di- and oligosaccharides Lactose and Galactose Uptake and Utilization  UDP-glucose 4-epimerase (EC 5.1.3.2)
  • PFAM:
    NADP_Rossmann (CL0063) Epimerase; NAD dependent epimerase/dehydratase family (PF01370; HMM-score: 209.3)
    GDP_Man_Dehyd; GDP-mannose 4,6 dehydratase (PF16363; HMM-score: 206.2)
    and 8 more
    3Beta_HSD; 3-beta hydroxysteroid dehydrogenase/isomerase family (PF01073; HMM-score: 49.3)
    RmlD_sub_bind; RmlD substrate binding domain (PF04321; HMM-score: 47)
    Polysacc_synt_2; Polysaccharide biosynthesis protein (PF02719; HMM-score: 38.9)
    NAD_binding_4; Male sterility protein (PF07993; HMM-score: 38.1)
    NAD_binding_10; NAD(P)H-binding (PF13460; HMM-score: 27.5)
    Sacchrp_dh_NADP; Saccharopine dehydrogenase NADP binding domain (PF03435; HMM-score: 19.5)
    adh_short; short chain dehydrogenase (PF00106; HMM-score: 18.6)
    KR; KR domain (PF08659; HMM-score: 15.3)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006183
    • TAT(Tat/SPI): 0.000224
    • LIPO(Sec/SPII): 0.001239
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MERVLITGGAGFIGSHLVDDLQQDYDVYVLDNYRTGKRENIKSLADDHVFELDIREYDAVEQIMKTYQFDYVIHLAALVSVAESVEKPILSQEINVVATLRLLEIIKKYNNHIKRFIFASSAAVYGDLPDLPKSDQSLILPLSPYAIDKYYGERTTLNYCSLYNIPTAVVKFFNVFGPRQDPKSQYSGVISKMFDSFEHNKPFTFFGDGLQTRDFVYVYDVVQSVRLIMEHKDAIGHGYNIGTGTFTNLLEVYRIIGELYGKSVEHEFKEARKGDIKHSYADISNLKALGFVPKYTVETGLKDYFNFEVDNIEEVTAKEVEMS

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]