From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0669 [new locus tag: SACOL_RS03460 ]
  • pan locus tag?: SAUPAN002480000
  • symbol: SACOL0669
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0669 [new locus tag: SACOL_RS03460 ]
  • symbol: SACOL0669
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 697384..697890
  • length: 507
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAAAAAGCTACTAACGGCAAGTATAATTGCATGTTCTGTTGTAATGGGAGTAGGCTTA
    GTGAACACTAGTGCCGAAGCAGCAAGTGGCAACTCTATTGATACTGTTAAACAATTAATT
    AAGGGTGATCAGTCATTAGAAAATGTGAAAATTGGCGAATCTATTAAAGATGTTTTAACT
    AAGTACAAAAATCCGATGTATTCTTACAATGAAGATGGAACTGAACATTATTACGAATTC
    CATACTAAAAAAGGTATGTTATTAGTAACTACTGATGGTAAGAAAAACAATGGTAAAGTA
    ACTCATATTTCAATGATGTATAATGATGCTAATGGTCCAACATATCAAGCTGTTAAAAAT
    TATGTTGGCAAAGCAGTAACACATACGGAATATAGCAAAGTTGCTGGTAATTTTGGATAT
    ATTGAAAAAGGCAAAACGACTTATCAATTTGCCTCAGCACCAAAAGATAAAAACATAAAA
    TTATATCGTATTGATTTGGAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    507


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0669 [new locus tag: SACOL_RS03460 ]
  • symbol: SACOL0669
  • description: hypothetical protein
  • length: 168
  • theoretical pI: 9.59726
  • theoretical MW: 18594.1
  • GRAVY: -0.497024

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01107935: hypothetical protein
  • PFAM:
    E-set (CL0159) DUF4179; Domain of unknown function (DUF4179) (PF13786; HMM-score: 10.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.0004
    • Cell wall & surface Score: 0.0033
    • Extracellular Score: 0.9963
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: -0.33
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: -2
    • Predicted Cleavage Site: TSAEAASG
  • SignalP: Signal peptide SP(Sec/SPI) length 27 aa
    • SP(Sec/SPI): 0.997919
    • TAT(Tat/SPI): 0.000501
    • LIPO(Sec/SPII): 0.001324
    • Cleavage Site: CS pos: 27-28. AEA-AS. Pr: 0.9493
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKKLLTASIIACSVVMGVGLVNTSAEAASGNSIDTVKQLIKGDQSLENVKIGESIKDVLTKYKNPMYSYNEDGTEHYYEFHTKKGMLLVTTDGKKNNGKVTHISMMYNDANGPTYQAVKNYVGKAVTHTEYSKVAGNFGYIEKGKTTYQFASAPKDKNIKLYRIDLEK

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Signal peptide containing [1] [2] [3] [4] [5]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 8.16 h [6]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Annette Dreisbach, Kristina Hempel, Girbe Buist, Michael Hecker, Dörte Becher, Jan Maarten van Dijl
    Profiling the surfacome of Staphylococcus aureus.
    Proteomics: 2010, 10(17);3082-96
    [PubMed:20662103] [WorldCat.org] [DOI] (I p)
  4. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  5. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  6. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]