Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0669 [new locus tag: SACOL_RS03460 ]
- pan locus tag?: SAUPAN002480000
- symbol: SACOL0669
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0669 [new locus tag: SACOL_RS03460 ]
- symbol: SACOL0669
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 697384..697890
- length: 507
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238294 NCBI
- RefSeq: YP_185553 NCBI
- BioCyc: see SACOL_RS03460
- MicrobesOnline: 912149 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGAAAAAGCTACTAACGGCAAGTATAATTGCATGTTCTGTTGTAATGGGAGTAGGCTTA
GTGAACACTAGTGCCGAAGCAGCAAGTGGCAACTCTATTGATACTGTTAAACAATTAATT
AAGGGTGATCAGTCATTAGAAAATGTGAAAATTGGCGAATCTATTAAAGATGTTTTAACT
AAGTACAAAAATCCGATGTATTCTTACAATGAAGATGGAACTGAACATTATTACGAATTC
CATACTAAAAAAGGTATGTTATTAGTAACTACTGATGGTAAGAAAAACAATGGTAAAGTA
ACTCATATTTCAATGATGTATAATGATGCTAATGGTCCAACATATCAAGCTGTTAAAAAT
TATGTTGGCAAAGCAGTAACACATACGGAATATAGCAAAGTTGCTGGTAATTTTGGATAT
ATTGAAAAAGGCAAAACGACTTATCAATTTGCCTCAGCACCAAAAGATAAAAACATAAAA
TTATATCGTATTGATTTGGAAAAATAA60
120
180
240
300
360
420
480
507
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0669 [new locus tag: SACOL_RS03460 ]
- symbol: SACOL0669
- description: hypothetical protein
- length: 168
- theoretical pI: 9.59726
- theoretical MW: 18594.1
- GRAVY: -0.497024
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01107935: hypothetical protein
- PFAM: E-set (CL0159) DUF4179; Domain of unknown function (DUF4179) (PF13786; HMM-score: 10.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helix: 1
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.0004
- Cell wall & surface Score: 0.0033
- Extracellular Score: 0.9963
- LocateP: Secretory(released) (with CS)
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: -0.33
- Signal peptide possibility: 1
- N-terminally Anchored Score: -2
- Predicted Cleavage Site: TSAEAASG
- SignalP: Signal peptide SP(Sec/SPI) length 27 aa
- SP(Sec/SPI): 0.997919
- TAT(Tat/SPI): 0.000501
- LIPO(Sec/SPII): 0.001324
- Cleavage Site: CS pos: 27-28. AEA-AS. Pr: 0.9493
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKLLTASIIACSVVMGVGLVNTSAEAASGNSIDTVKQLIKGDQSLENVKIGESIKDVLTKYKNPMYSYNEDGTEHYYEFHTKKGMLLVTTDGKKNNGKVTHISMMYNDANGPTYQAVKNYVGKAVTHTEYSKVAGNFGYIEKGKTTYQFASAPKDKNIKLYRIDLEK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Signal peptide containing [1] [2] [3] [4] [5]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 8.16 h [6]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Annette Dreisbach, Kristina Hempel, Girbe Buist, Michael Hecker, Dörte Becher, Jan Maarten van Dijl
Profiling the surfacome of Staphylococcus aureus.
Proteomics: 2010, 10(17);3082-96
[PubMed:20662103] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)