Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0771 [new locus tag: SACOL_RS03960 ]
- pan locus tag?: SAUPAN002597000
- symbol: SACOL0771
- pan gene symbol?: queD
- synonym:
- product: 6-pyruvoyl tetrahydrobiopterin synthase
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0771 [new locus tag: SACOL_RS03960 ]
- symbol: SACOL0771
- product: 6-pyruvoyl tetrahydrobiopterin synthase
- replicon: chromosome
- strand: -
- coordinates: 792382..792801
- length: 420
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237928 NCBI
- RefSeq: YP_185648 NCBI
- BioCyc: see SACOL_RS03960
- MicrobesOnline: 912245 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTTACAACAAATCTATCCTAGTACAACGCATCCATATCAATTCGAATTAAATAAAGAT
TTTAATTTTTCGGCTGCACATCACATTCCATGTGAAGAAGCAGGTATTTGTCAAAATGTC
CATGGTCATACTTACTTTGTTAATTTAACAATTGTCGGTGATAAACTAGATGACACTGGC
TTCTTAGTGAACTTTAGCCATTTGAAAAAGATGATACACGGTAAATTTGACCATCAACTG
TTAAATAACTTACCTGCTTTTAAAAACAAAATCCCTTCAACTGAAATCGTAGCGGAAACA
ATTTATCAAATTGTTAAAGAAAATTTGGCATCGCTCGAACACCAACCAAAATGTATTCAA
GTATTTGTAAGAGAAACACCAACAAGTTATGTCGTATTTAGACCAAAGGAACAGGTGTAA60
120
180
240
300
360
420
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0771 [new locus tag: SACOL_RS03960 ]
- symbol: SACOL0771
- description: 6-pyruvoyl tetrahydrobiopterin synthase
- length: 139
- theoretical pI: 7.01376
- theoretical MW: 16011.2
- GRAVY: -0.274101
⊟Function[edit | edit source]
- reaction: EC 4.1.2.50 ExPASy6-carboxytetrahydropterin synthase 7,8-dihydroneopterin 3'-triphosphate + H2O = 6-carboxy-5,6,7,8-tetrahydropterin + acetaldehyde + triphosphate?
- TIGRFAM: Protein synthesis tRNA and rRNA base modification 6-pyruvoyl tetrahydropterin synthase/QueD family protein (TIGR00039; HMM-score: 100.7)Protein synthesis tRNA and rRNA base modification queuosine biosynthesis protein QueD (TIGR03367; HMM-score: 93.8)and 1 more6-pyruvoyl tetrahydropterin synthase-related domain (TIGR03112; HMM-score: 30.8)
- TheSEED :
- 6-carboxytetrahydropterin synthase (EC 4.1.2.50)
- PFAM: THBO-biosyn (CL0334) PTPS; 6-pyruvoyl tetrahydropterin synthase (PF01242; HMM-score: 113.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors: Zn2+
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9943
- Cytoplasmic Membrane Score: 0.002
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0035
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007616
- TAT(Tat/SPI): 0.000436
- LIPO(Sec/SPII): 0.00065
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLQQIYPSTTHPYQFELNKDFNFSAAHHIPCEEAGICQNVHGHTYFVNLTIVGDKLDDTGFLVNFSHLKKMIHGKFDHQLLNNLPAFKNKIPSTEIVAETIYQIVKENLASLEHQPKCIQVFVRETPTSYVVFRPKEQV
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: Cytoplasmic [1]
- quantitative data / protein copy number per cell: 73 [2]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulators: PreQ1 riboswitch (transcription termination) regulon, SigB* (activation) regulon
PreQ1 riboswitch (RNA) important in Queuosine biosynthesis; transcription unit transferred from N315 data RegPrecise SigB* (sigma factor) controlling a large regulon involved in stress/starvation response and adaptation; [3] other strains
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 15.91 h [4]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)