From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0770 [new locus tag: SACOL_RS03955 ]
  • pan locus tag?: SAUPAN002596000
  • symbol: SACOL0770
  • pan gene symbol?: queE
  • synonym:
  • product: radical activating enzyme family protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0770 [new locus tag: SACOL_RS03955 ]
  • symbol: SACOL0770
  • product: radical activating enzyme family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 791665..792378
  • length: 714
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGGCTAAAATTCCTGTACTCGAAATATTCGGTCCAACCATTCAGGGTGAAGGTCGAGTA
    ATCGGTAGAAAAACGATGTTTGTGAGAACAGCTGGATGTGATTATCGCTGTAGCTGGTGT
    GATTCTGCATTTACTTGGGATGGTAGTGCTAAAGGCGATATAAAACTCATGACCGCTGAA
    GAAATTTATGATGAATTAAAACGAATTGGTGGCGATTTATTTAACCACGTTACAATTTCT
    GGTGGTAACCCAGCATTAATTAAAGGTATCCAAGAGTTAGTTGACTTATTTCAAGATAAA
    GGTATTTTCAGCGCACTGGAGACACAAGGCAGTAAATTCCAACCTTGGATGACACAAATT
    GATGATTTAACGATTAGTCCAAAACCACCAAGTTCAACTATGACACCTGATTTAAAAAAG
    TTAGATGAAGTGATTACACAATGCGTACCTTCATCATTAAACTTAAAAGTAGTTGTATTC
    GACGATAAAGATTATGATTTTGCCAAAATGATACACCACCGTTATCCAGATATTCCCTTC
    TATTTACAAGTTGGTAACCCATATTTATCAGACAGCGTAGATAATCATACCGAAAAGTTG
    TTAGAACGCTACGAGCAGTTGGTGGATTTAGTTATGCAAAGTAATGATATGAATCACGTT
    TATGTGTTACCACAACTTCATACATTACTTTGGAGCAATAAAAAAGGTGTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    714


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0770 [new locus tag: SACOL_RS03955 ]
  • symbol: SACOL0770
  • description: radical activating enzyme family protein
  • length: 237
  • theoretical pI: 5.10847
  • theoretical MW: 26820.6
  • GRAVY: -0.253587

Function[edit | edit source]

  • reaction:
    EC 4.3.99.3?  ExPASy
    7-carboxy-7-deazaguanine synthase 6-carboxy-5,6,7,8-tetrahydropterin = 7-carboxy-7-carbaguanine + NH3
  • TIGRFAM:
    Genetic information processing Protein synthesis tRNA and rRNA base modification 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR03365; HMM-score: 382.7)
    and 33 more
    Genetic information processing Protein synthesis tRNA and rRNA base modification putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR03963; HMM-score: 93.4)
    putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR04349; HMM-score: 77.6)
    putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR04322; HMM-score: 55.2)
    7-carboxy-7-deazaguanine synthase (TIGR04508; EC 4.3.99.3; HMM-score: 46.8)
    Genetic information processing Protein fate Protein modification and repair anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 37.8)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 37.8)
    Genetic information processing Protein fate Protein modification and repair pyruvate formate-lyase 1-activating enzyme (TIGR02493; EC 1.97.1.4; HMM-score: 37.3)
    Metabolism Energy metabolism Anaerobic pyruvate formate-lyase 1-activating enzyme (TIGR02493; EC 1.97.1.4; HMM-score: 37.3)
    Genetic information processing Protein fate Protein modification and repair anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02491; EC 1.97.1.-; HMM-score: 31.2)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02491; EC 1.97.1.-; HMM-score: 31.2)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdenum cofactor biosynthesis protein A (TIGR02666; HMM-score: 23.4)
    SynChlorMet cassette radical SAM/SPASM protein ScmF (TIGR04251; HMM-score: 21)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other coenzyme PQQ biosynthesis enzyme PqqE (TIGR02109; HMM-score: 19)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin probable molybdenum cofactor biosynthesis protein A (TIGR02668; HMM-score: 19)
    pseudo-rSAM protein/SPASM domain protein (TIGR04347; HMM-score: 19)
    Unknown function Enzymes of unknown specificity mycofactocin radical SAM maturase (TIGR03962; HMM-score: 18.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin heme b synthase (TIGR04545; EC 1.3.99.-; HMM-score: 18.8)
    glycyl-radical enzyme activating protein (TIGR02494; EC 1.97.1.-; HMM-score: 18.6)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02826; EC 1.97.1.-; HMM-score: 18.3)
    tungsten cofactor oxidoreducase radical SAM maturase (TIGR04317; HMM-score: 18)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin heme d1 biosynthesis radical SAM protein NirJ (TIGR04051; HMM-score: 17.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin putative heme d1 biosynthesis radical SAM protein NirJ1 (TIGR04054; HMM-score: 17.6)
    sporulation killing factor system radical SAM maturase (TIGR04403; HMM-score: 16.7)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin putative heme d1 biosynthesis radical SAM protein NirJ2 (TIGR04055; EC 1.3.99.-; HMM-score: 16.4)
    Unknown function Enzymes of unknown specificity Y_X(10)_GDL-associated radical SAM protein (TIGR03913; HMM-score: 16.2)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin 12,18-didecarboxysiroheme deacetylase (TIGR04546; HMM-score: 16.2)
    His-Xaa-Ser system radical SAM maturase HxsB (TIGR03978; HMM-score: 15.4)
    selenobiotic family peptide radical SAM maturase (TIGR04082; HMM-score: 15.4)
    Genetic information processing Protein fate Protein modification and repair [benzylsuccinate synthase]-activating enzyme (TIGR04003; EC 1.97.-.-; HMM-score: 14.9)
    SynChlorMet cassette radical SAM/SPASM protein ScmE (TIGR04250; HMM-score: 14)
    radical SAM/SPASM domain protein, ACGX system (TIGR04340; HMM-score: 13.3)
    His-Xaa-Ser system radical SAM maturase HxsC (TIGR03977; HMM-score: 12.7)
    putative peptide-modifying radical SAM enzyme, Mhun_1560 family (TIGR04083; HMM-score: 12.7)
  • TheSEED  :
    • 7-carboxy-7-deazaguanine synthase (EC 4.3.99.3)
    RNA Metabolism RNA processing and modification Queuosine-Archaeosine Biosynthesis  Queuosine Biosynthesis QueE Radical SAM
  • PFAM:
    TIM_barrel (CL0036) Radical_SAM; Radical SAM superfamily (PF04055; HMM-score: 44)
    and 4 more
    4Fe-4S (CL0344) Fer4_12; 4Fe-4S single cluster domain (PF13353; HMM-score: 30.4)
    no clan defined Histone_H2A_C; C-terminus of histone H2A (PF16211; HMM-score: 14)
    TPR (CL0020) CID; CID domain (PF04818; HMM-score: 12.2)
    no clan defined ApoB100_C; Apolipoprotein B100 C terminal (PF12491; HMM-score: 10.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors: Mg2+, S-adenosyl-L-methionine, [4Fe-4S] cluster
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9756
    • Cytoplasmic Membrane Score: 0.0103
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0139
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.137293
    • TAT(Tat/SPI): 0.001469
    • LIPO(Sec/SPII): 0.019113
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MAKIPVLEIFGPTIQGEGRVIGRKTMFVRTAGCDYRCSWCDSAFTWDGSAKGDIKLMTAEEIYDELKRIGGDLFNHVTISGGNPALIKGIQELVDLFQDKGIFSALETQGSKFQPWMTQIDDLTISPKPPSSTMTPDLKKLDEVITQCVPSSLNLKVVVFDDKDYDFAKMIHHRYPDIPFYLQVGNPYLSDSVDNHTEKLLERYEQLVDLVMQSNDMNHVYVLPQLHTLLWSNKKGV

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: Cytoplasmic [1]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulators: PreQ1 riboswitch (transcription termination) regulon, SigB* (activation) regulon
    PreQ1 riboswitch(RNA)important in Queuosine biosynthesis; transcription unit transferred from N315 data RegPrecise 
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [2]   other strains

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  2. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

Relevant publications[edit | edit source]