From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00719
  • pan locus tag?: SAUPAN002596000
  • symbol: SAOUHSC_00719
  • pan gene symbol?: queE
  • synonym:
  • product: 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00719
  • symbol: SAOUHSC_00719
  • product: 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE
  • replicon: chromosome
  • strand: -
  • coordinates: 703128..703841
  • length: 714
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGGCTAAAATTCCTGTACTCGAAATATTCGGTCCAACCATTCAGGGTGAAGGTCGAGTA
    ATCGGTAGAAAAACGATGTTTGTGAGAACAGCTGGATGTGATTATCGCTGTAGCTGGTGT
    GATTCTGCATTTACTTGGGATGGTAGTGCTAAAGGCGATATAAAACTCATGACCGCTGAA
    GAAATTTATGATGAATTAAAACGAATTGGTGGCGATTTATTTAACCACGTTACAATTTCT
    GGTGGTAACCCAGCATTAATTAAAGGTATCCAAGAGTTAGTTGACTTATTTCAAGATAAA
    GGTATTTTCAGCGCACTGGAGACACAAGGCAGTAAATTCCAACCTTGGATGACACAAATT
    GATGATTTAACGATTAGTCCAAAACCACCAAGTTCAACTATGACACCTGATTTAAAAAAG
    TTAGATGAAGTGATTACACAATGCGTACCTTCATCATTAAACTTAAAAGTAGTTGTATTC
    GACGATAAAGATTATGATTTTGCCAAAATGATACACCACCGTTATCCAGATATTCCCTTC
    TATTTACAAGTTGGTAACCCATATTTATCAGACAGCGTAGATAATCATACCGAAAAGTTG
    TTAGAACGCTACGAGCAGTTGGTGGATTTAGTTATGCAAAGTAATGATATGAATCACGTT
    TATGTGTTACCACAACTTCATACATTACTTTGGAGCAATAAAAAAGGTGTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    714


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_00719
  • symbol: SAOUHSC_00719
  • description: 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE
  • length: 237
  • theoretical pI: 5.10847
  • theoretical MW: 26820.6
  • GRAVY: -0.253587

Function[edit | edit source]

  • reaction:
    EC 4.3.99.3?  ExPASy
    7-carboxy-7-deazaguanine synthase 6-carboxy-5,6,7,8-tetrahydropterin = 7-carboxy-7-carbaguanine + NH3
  • TIGRFAM:
    Genetic information processing Protein synthesis tRNA and rRNA base modification 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR03365; HMM-score: 382.7)
    and 33 more
    Genetic information processing Protein synthesis tRNA and rRNA base modification putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR03963; HMM-score: 93.4)
    putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR04349; HMM-score: 77.6)
    putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR04322; HMM-score: 55.2)
    7-carboxy-7-deazaguanine synthase (TIGR04508; EC 4.3.99.3; HMM-score: 46.8)
    Genetic information processing Protein fate Protein modification and repair anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 37.8)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 37.8)
    Genetic information processing Protein fate Protein modification and repair pyruvate formate-lyase 1-activating enzyme (TIGR02493; EC 1.97.1.4; HMM-score: 37.3)
    Metabolism Energy metabolism Anaerobic pyruvate formate-lyase 1-activating enzyme (TIGR02493; EC 1.97.1.4; HMM-score: 37.3)
    Genetic information processing Protein fate Protein modification and repair anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02491; EC 1.97.1.-; HMM-score: 31.2)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02491; EC 1.97.1.-; HMM-score: 31.2)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdenum cofactor biosynthesis protein A (TIGR02666; HMM-score: 23.4)
    SynChlorMet cassette radical SAM/SPASM protein ScmF (TIGR04251; HMM-score: 21)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other coenzyme PQQ biosynthesis enzyme PqqE (TIGR02109; HMM-score: 19)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin probable molybdenum cofactor biosynthesis protein A (TIGR02668; HMM-score: 19)
    pseudo-rSAM protein/SPASM domain protein (TIGR04347; HMM-score: 19)
    Unknown function Enzymes of unknown specificity mycofactocin radical SAM maturase (TIGR03962; HMM-score: 18.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin heme b synthase (TIGR04545; EC 1.3.99.-; HMM-score: 18.8)
    glycyl-radical enzyme activating protein (TIGR02494; EC 1.97.1.-; HMM-score: 18.6)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02826; EC 1.97.1.-; HMM-score: 18.3)
    tungsten cofactor oxidoreducase radical SAM maturase (TIGR04317; HMM-score: 18)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin heme d1 biosynthesis radical SAM protein NirJ (TIGR04051; HMM-score: 17.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin putative heme d1 biosynthesis radical SAM protein NirJ1 (TIGR04054; HMM-score: 17.6)
    sporulation killing factor system radical SAM maturase (TIGR04403; HMM-score: 16.7)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin putative heme d1 biosynthesis radical SAM protein NirJ2 (TIGR04055; EC 1.3.99.-; HMM-score: 16.4)
    Unknown function Enzymes of unknown specificity Y_X(10)_GDL-associated radical SAM protein (TIGR03913; HMM-score: 16.2)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin 12,18-didecarboxysiroheme deacetylase (TIGR04546; HMM-score: 16.2)
    His-Xaa-Ser system radical SAM maturase HxsB (TIGR03978; HMM-score: 15.4)
    selenobiotic family peptide radical SAM maturase (TIGR04082; HMM-score: 15.4)
    Genetic information processing Protein fate Protein modification and repair [benzylsuccinate synthase]-activating enzyme (TIGR04003; EC 1.97.-.-; HMM-score: 14.9)
    SynChlorMet cassette radical SAM/SPASM protein ScmE (TIGR04250; HMM-score: 14)
    radical SAM/SPASM domain protein, ACGX system (TIGR04340; HMM-score: 13.3)
    His-Xaa-Ser system radical SAM maturase HxsC (TIGR03977; HMM-score: 12.7)
    putative peptide-modifying radical SAM enzyme, Mhun_1560 family (TIGR04083; HMM-score: 12.7)
  • TheSEED  :
    • 7-carboxy-7-deazaguanine synthase (EC 4.3.99.3)
    RNA Metabolism RNA processing and modification Queuosine-Archaeosine Biosynthesis  Queuosine Biosynthesis QueE Radical SAM
  • PFAM:
    TIM_barrel (CL0036) Radical_SAM; Radical SAM superfamily (PF04055; HMM-score: 44)
    and 4 more
    4Fe-4S (CL0344) Fer4_12; 4Fe-4S single cluster domain (PF13353; HMM-score: 30.4)
    no clan defined Histone_H2A_C; C-terminus of histone H2A (PF16211; HMM-score: 14)
    TPR (CL0020) CID; CID domain (PF04818; HMM-score: 12.2)
    no clan defined ApoB100_C; Apolipoprotein B100 C terminal (PF12491; HMM-score: 10.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors: Mg2+, S-adenosyl-L-methionine, [4Fe-4S] cluster
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9756
    • Cytoplasmic Membrane Score: 0.0103
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0139
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.137293
    • TAT(Tat/SPI): 0.001469
    • LIPO(Sec/SPII): 0.019113
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MAKIPVLEIFGPTIQGEGRVIGRKTMFVRTAGCDYRCSWCDSAFTWDGSAKGDIKLMTAEEIYDELKRIGGDLFNHVTISGGNPALIKGIQELVDLFQDKGIFSALETQGSKFQPWMTQIDDLTISPKPPSSTMTPDLKKLDEVITQCVPSSLNLKVVVFDDKDYDFAKMIHHRYPDIPFYLQVGNPYLSDSVDNHTEKLLERYEQLVDLVMQSNDMNHVYVLPQLHTLLWSNKKGV

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulators: PreQ1 riboswitch (transcription termination) regulon, SigB* (activation) regulon
    PreQ1 riboswitch(5' cis-acting region)important in Queuosine biosynthesis; transcription unit transferred from N315 data RegPrecise 
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [3]   other strains

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. 3.0 3.1 3.2 3.3 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]