From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0773 [new locus tag: SACOL_RS03970 ]
  • pan locus tag?: SAUPAN002599000
  • symbol: pabA
  • pan gene symbol?: pabA
  • synonym:
  • product: para-aminobenzoate synthase, glutamine amidotransferase, component II

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0773 [new locus tag: SACOL_RS03970 ]
  • symbol: pabA
  • product: para-aminobenzoate synthase, glutamine amidotransferase, component II
  • replicon: chromosome
  • strand: +
  • coordinates: 793822..794415
  • length: 594
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGATTCTAGTCATAGATAATAATGATTCATTTACATATAATTTAATAGACTATATTAAG
    ACTCAAACGAAACTAACAGTTCAAGTTGTTGGTATTGATAATCTGCTGATAGAAGACGTC
    ATTAATATGAAGCCAAAAGCAATTGTTATTTCGCCTGGGCCGGGTAATCCGGATGATTAT
    CCTATCTTGAATGAAGTGTTAGAACAATTTTATCAGCGTGTACCTATACTAGGTGTATGT
    TTAGGATTTCAATGTATCGTGTCTTATTTTGGTGGAAATATCATTCACGGCTATCATCCT
    GTACACGGACATACTACACAGTTACGCCATACCAATGAAGGTATTTTTCAAGGACTGCCT
    CAAAATTTCAATGTAATGCGTTATCATTCATTAATTGCTGACGGAGCGACTTTTCCAAAT
    TGCTTAAAGATTACAGCAAAAAACGATGAAGCGATTATTATGGCATTTGAGCATATTAGA
    TTTCCGGTTTTTGGTGTGCAATATCATCCTGAATCTATTTTGAGTGAATACGGTTATCGA
    CAAGTTGAATTATTTTTATCGAAGGTAGGTGATTACTGTGAGAATAGAATATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    594

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0773 [new locus tag: SACOL_RS03970 ]
  • symbol: PabA
  • description: para-aminobenzoate synthase, glutamine amidotransferase, component II
  • length: 197
  • theoretical pI: 5.79556
  • theoretical MW: 22377.5
  • GRAVY: 0.0126904

Function[edit | edit source]

  • reaction:
    EC 4.1.3.27?  ExPASy
    Anthranilate synthase Chorismate + L-glutamine = anthranilate + pyruvate + L-glutamate
  • TIGRFAM:
    glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase (TIGR00566; HMM-score: 184.5)
    Metabolism Amino acid biosynthesis Aromatic amino acid family anthranilate synthase (TIGR01815; EC 4.1.3.27; HMM-score: 154.8)
    and 6 more
    aminodeoxychorismate synthase (TIGR01823; EC 2.6.1.85; HMM-score: 140.2)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis GMP synthase (glutamine-hydrolyzing), N-terminal domain (TIGR00888; EC 6.3.5.2; HMM-score: 90.5)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Pyrimidine ribonucleotide biosynthesis carbamoyl-phosphate synthase, small subunit (TIGR01368; EC 6.3.5.5; HMM-score: 62.5)
    Metabolism Amino acid biosynthesis Histidine family imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (TIGR01855; EC 2.4.2.-; HMM-score: 18.1)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Pyrimidine ribonucleotide biosynthesis CTP synthase (TIGR00337; EC 6.3.4.2; HMM-score: 15.9)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis phosphoribosylformylglycinamidine synthase I (TIGR01737; EC 6.3.5.3; HMM-score: 12.2)
  • TheSEED  :
    • Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)
    Amino Acids and Derivatives Aromatic amino acids and derivatives Tryptophan synthesis  Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)
    and 1 more
    Cofactors, Vitamins, Prosthetic Groups, Pigments Folate and pterines Folate Biosynthesis  Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)
  • PFAM:
    Glutaminase_I (CL0014) GATase; Glutamine amidotransferase class-I (PF00117; HMM-score: 153.5)
    and 1 more
    Peptidase_C26; Peptidase C26 (PF07722; HMM-score: 41.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004633
    • TAT(Tat/SPI): 0.000105
    • LIPO(Sec/SPII): 0.000249
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MILVIDNNDSFTYNLIDYIKTQTKLTVQVVGIDNLLIEDVINMKPKAIVISPGPGNPDDYPILNEVLEQFYQRVPILGVCLGFQCIVSYFGGNIIHGYHPVHGHTTQLRHTNEGIFQGLPQNFNVMRYHSLIADGATFPNCLKITAKNDEAIIMAFEHIRFPVFGVQYHPESILSEYGYRQVELFLSKVGDYCENRI

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3] [4]
  • quantitative data / protein copy number per cell: 205 [5]
  • interaction partners:
    SACOL1734(gapA2)glyceraldehyde 3-phosphate dehydrogenase 2  [6] (data from MRSA252)
    SACOL1961(gatA)aspartyl/glutamyl-tRNA amidotransferase subunit A  [6] (data from MRSA252)
    SACOL0222(ldh1)L-lactate dehydrogenase  [6] (data from MRSA252)
    SACOL1274(rpsB)30S ribosomal protein S2  [6] (data from MRSA252)
    SACOL2104(upp)uracil phosphoribosyltransferase  [6] (data from MRSA252)
    SACOL2553pyruvate oxidase  [6] (data from MRSA252)
    SACOL2561hydroxymethylglutaryl-CoA synthase  [6] (data from MRSA252)

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  6. 6.0 6.1 6.2 6.3 6.4 6.5 6.6 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]