Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2104 [new locus tag: SACOL_RS11010 ]
- pan locus tag?: SAUPAN005403000
- symbol: upp
- pan gene symbol?: upp
- synonym:
- product: uracil phosphoribosyltransferase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2104 [new locus tag: SACOL_RS11010 ]
- symbol: upp
- product: uracil phosphoribosyltransferase
- replicon: chromosome
- strand: -
- coordinates: 2164933..2165562
- length: 630
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237485 NCBI
- RefSeq: YP_186919 NCBI
- BioCyc:
- MicrobesOnline: 913580 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGAGTAAAGTACACGTTTTCGATCATCCATTAATTCAACACAAACTAAGCTATATTAGA
GATGTAAATACAGGTACTAAAGAATTTAGAGAACTTGTAGACGAAGTTGGTATGTTGATG
GCATATGAAGTAACTAGAGACTTAGAGCTTCAGGATGTTGATATTGAAACGCCTGTAACT
AAAATGACGGCTAAACGATTAGCTGGTAAAAAATTAGCTATCGTTCCAATTTTAAGAGCT
GGTTTAGGTATGACTGATGGTATTTTAAGTTTAGTACCTGCAGCCAGAGTTGGACATATC
GGTTTATATCGAGATCCCGAAACATTAAAGGCTGTAGAGTATTTTGCTAAGTTACCTCAA
GATATTACTGAAAGACAAATCATTGTTGTTGATCCTATGTTAGCAACAGGCGCATCAGCA
ATTGAAGCTATTACTTCATTGAAGAAACGTGGCGCTAAAAATATTCGCTTCATGTGTTTA
ATTGCAGCACCAGAAGGCGTAGAAAAGATGCATGAAGCACATCCAGATGTAGATATTTAT
ATTGCTGCACTTGATGAAAAGCTAAATGACAAAGCATATATCACACCAGGGTTAGGCGAC
GCTGGAGATAGATTGTTTGGTACTAAATAG60
120
180
240
300
360
420
480
540
600
630
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2104 [new locus tag: SACOL_RS11010 ]
- symbol: Upp
- description: uracil phosphoribosyltransferase
- length: 209
- theoretical pI: 6.52063
- theoretical MW: 23049.7
- GRAVY: -0.0320574
⊟Function[edit | edit source]
- reaction: EC 2.4.2.9? ExPASyUracil phosphoribosyltransferase UMP + diphosphate = uracil + 5-phospho-alpha-D-ribose 1-diphosphate
- TIGRFAM: Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uracil phosphoribosyltransferase (TIGR01091; EC 2.4.2.9; HMM-score: 304.6)and 6 morePurines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis ribose-phosphate diphosphokinase (TIGR01251; EC 2.7.6.1; HMM-score: 27.5)Purines, pyrimidines, nucleosides, and nucleotides Pyrimidine ribonucleotide biosynthesis orotate phosphoribosyltransferase (TIGR01367; EC 2.4.2.10; HMM-score: 23)Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides hypoxanthine phosphoribosyltransferase (TIGR01203; EC 2.4.2.8; HMM-score: 22.8)Cellular processes DNA transformation comF family protein (TIGR00201; HMM-score: 17.1)Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides adenine phosphoribosyltransferase (TIGR01090; EC 2.4.2.7; HMM-score: 12.9)Purines, pyrimidines, nucleosides, and nucleotides Pyrimidine ribonucleotide biosynthesis orotate phosphoribosyltransferase (TIGR00336; EC 2.4.2.10; HMM-score: 12.1)
- TheSEED :
- Uracil phosphoribosyltransferase (EC 2.4.2.9)
Nucleosides and Nucleotides Pyrimidines De Novo Pyrimidine Synthesis Uracil phosphoribosyltransferase (EC 2.4.2.9)and 1 more - PFAM: PRTase-like (CL0533) UPRTase; Uracil phosphoribosyltransferase (PF14681; HMM-score: 258.9)and 1 morePribosyltran; Phosphoribosyl transferase domain (PF00156; HMM-score: 42.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors: Mg2+
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002006
- TAT(Tat/SPI): 0.000137
- LIPO(Sec/SPII): 0.000193
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSKVHVFDHPLIQHKLSYIRDVNTGTKEFRELVDEVGMLMAYEVTRDLELQDVDIETPVTKMTAKRLAGKKLAIVPILRAGLGMTDGILSLVPAARVGHIGLYRDPETLKAVEYFAKLPQDITERQIIVVDPMLATGASAIEAITSLKKRGAKNIRFMCLIAAPEGVEKMHEAHPDVDIYIAALDEKLNDKAYITPGLGDAGDRLFGTK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3] [4]
- quantitative data / protein copy number per cell: 2112 [5]
- interaction partners:
SACOL1102 (pdhA) pyruvate dehydrogenase complex E1 component subunit alpha [6] (data from MRSA252) SACOL1103 (pdhB) pyruvate dehydrogenase complex E1 component subunit beta [6] (data from MRSA252) SACOL1104 (pdhC) branched-chain alpha-keto acid dehydrogenase E2 [6] (data from MRSA252) SACOL1105 (pdhD) dihydrolipoamide dehydrogenase [6] (data from MRSA252) SACOL2236 (rplB) 50S ribosomal protein L2 [6] (data from MRSA252) SACOL0585 (rplJ) 50S ribosomal protein L10 [6] (data from MRSA252) SACOL2234 (rplV) 50S ribosomal protein L22 [6] (data from MRSA252) SACOL1274 (rpsB) 30S ribosomal protein S2 [6] (data from MRSA252) SACOL1448 (sucB) dihydrolipoamide succinyltransferase [6] (data from MRSA252) SACOL0594 (tuf) elongation factor Tu [6] (data from MRSA252) SACOL2569 1-pyrroline-5-carboxylate dehydrogenase [6] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SACOL2103 < upp < glyA < SACOL2106
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ 6.00 6.01 6.02 6.03 6.04 6.05 6.06 6.07 6.08 6.09 6.10 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]