From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00722
  • pan locus tag?: SAUPAN002599000
  • symbol: SAOUHSC_00722
  • pan gene symbol?: pabA
  • synonym:
  • product: para-aminobenzoate synthase glutamine amidotransferase component II

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00722
  • symbol: SAOUHSC_00722
  • product: para-aminobenzoate synthase glutamine amidotransferase component II
  • replicon: chromosome
  • strand: +
  • coordinates: 705285..705878
  • length: 594
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGATTCTAGTCATAGATAATAATGATTCATTTACATATAATTTAATAGACTATATTAAG
    ACTCAAACGAAACTAACAGTTCAAGTTGTTGGTATTGATAATCTGCTGATAGAAGACGTC
    ATTAATATGAAGCCAAAAGCAATTGTTATTTCGCCTGGGCCGGGTAATCCGGATGATTAT
    CCTATCTTGAATGAAGTGTTAGAACAATTTTATCAGCGTGTACCTATACTAGGTGTATGT
    TTAGGATTTCAATGTATCGTGTCTTATTTTGGTGGAAATATCATTCACGGCTATCATCCT
    GTACACGGACATACTACACAGTTACGCCATACCAATGAAGGTATTTTTCAAGGACTGCCT
    CAAAATTTCAATGTAATGCGTTATCATTCATTAATTGCTGACGGAGCGACTTTTCCAAAT
    TGCTTAAAGATTACAGCAAAAAACGATGAAGCGATTATTATGGCATTTGAGCATATTAGA
    TTTCCGGTTTTTGGTGTGCAATATCATCCTGAATCTATTTTGAGTGAATACGGTTATCGA
    CAAGTTGAATTATTTTTATCGAAGGTAGGTGATTACTGTGAGAATAGAATATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    594

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_00722
  • symbol: SAOUHSC_00722
  • description: para-aminobenzoate synthase glutamine amidotransferase component II
  • length: 197
  • theoretical pI: 5.79556
  • theoretical MW: 22377.5
  • GRAVY: 0.0126904

Function[edit | edit source]

  • reaction:
    EC 4.1.3.27?  ExPASy
    Anthranilate synthase Chorismate + L-glutamine = anthranilate + pyruvate + L-glutamate
  • TIGRFAM:
    glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase (TIGR00566; HMM-score: 184.5)
    Metabolism Amino acid biosynthesis Aromatic amino acid family anthranilate synthase (TIGR01815; EC 4.1.3.27; HMM-score: 154.8)
    and 6 more
    aminodeoxychorismate synthase (TIGR01823; EC 2.6.1.85; HMM-score: 140.2)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis GMP synthase (glutamine-hydrolyzing), N-terminal domain (TIGR00888; EC 6.3.5.2; HMM-score: 90.5)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Pyrimidine ribonucleotide biosynthesis carbamoyl-phosphate synthase, small subunit (TIGR01368; EC 6.3.5.5; HMM-score: 62.5)
    Metabolism Amino acid biosynthesis Histidine family imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (TIGR01855; EC 2.4.2.-; HMM-score: 18.1)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Pyrimidine ribonucleotide biosynthesis CTP synthase (TIGR00337; EC 6.3.4.2; HMM-score: 15.9)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis phosphoribosylformylglycinamidine synthase I (TIGR01737; EC 6.3.5.3; HMM-score: 12.2)
  • TheSEED  :
    • Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)
    Amino Acids and Derivatives Aromatic amino acids and derivatives Tryptophan synthesis  Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)
    and 1 more
    Cofactors, Vitamins, Prosthetic Groups, Pigments Folate and pterines Folate Biosynthesis  Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)
  • PFAM:
    Glutaminase_I (CL0014) GATase; Glutamine amidotransferase class-I (PF00117; HMM-score: 172.5)
    and 1 more
    Peptidase_C26; Peptidase C26 (PF07722; HMM-score: 41.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9846
    • Cytoplasmic Membrane Score: 0.0001
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0151
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004633
    • TAT(Tat/SPI): 0.000105
    • LIPO(Sec/SPII): 0.000249
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MILVIDNNDSFTYNLIDYIKTQTKLTVQVVGIDNLLIEDVINMKPKAIVISPGPGNPDDYPILNEVLEQFYQRVPILGVCLGFQCIVSYFGGNIIHGYHPVHGHTTQLRHTNEGIFQGLPQNFNVMRYHSLIADGATFPNCLKITAKNDEAIIMAFEHIRFPVFGVQYHPESILSEYGYRQVELFLSKVGDYCENRI

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:
    SAOUHSC_02117(gatA)aspartyl/glutamyl-tRNA amidotransferase subunit A  [3] (data from MRSA252)
    SAOUHSC_01232(rpsB)30S ribosomal protein S2  [3] (data from MRSA252)
    SAOUHSC_02353(upp)uracil phosphoribosyltransferase  [3] (data from MRSA252)
    SAOUHSC_00206L-lactate dehydrogenase  [3] (data from MRSA252)
    SAOUHSC_01794glyceraldehyde 3-phosphate dehydrogenase 2  [3] (data from MRSA252)
    SAOUHSC_02849pyruvate oxidase  [3] (data from MRSA252)
    SAOUHSC_02860HMG-CoA synthase  [3] (data from MRSA252)

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. 3.0 3.1 3.2 3.3 3.4 3.5 3.6 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  4. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]