From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0888 [new locus tag: SACOL_RS04560 ]
  • pan locus tag?: SAUPAN002846000
  • symbol: SACOL0888
  • pan gene symbol?:
  • synonym:
  • product: pathogenicity island, lipoprotein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0888 [new locus tag: SACOL_RS04560 ]
  • symbol: SACOL0888
  • product: pathogenicity island, lipoprotein
  • replicon: chromosome
  • strand: -
  • coordinates: 906350..906781
  • length: 432
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAGAAAATTATTAGGTTTAGCATTAGCAAGTACGTTAATTTTAGGCGCTTGTGGTAGC
    AACGACGGAGATAAGAAAGAAGAAAGCAAGAGCTATACTACAAATGATATCGTTAAAGGT
    TTTAAAGATAATAAATTAAATGTTATCAATGAAAAAGAAATGACACGTGAAGACTTTGGG
    CTTGCTCCAATGAAGACGGACGAAGCTAAAATGTTTGTTGTTCAAGATGATAAAAATGCT
    AGAGTAATGAAATTTAAAAATAGTGATGATCTAAAACAAACTAAAAAATATTACGATGAA
    TTAGGTAAAGAAAGTGCAGCTTTCTATTCACATACCCATTCTAAAGGTAAGTTTTTAATA
    CAAATGAACGGTGATATCGATGATGCTACTTTCAATAAATACAAGAATTCTATGGATAAA
    ACATTAAAGTGA
    60
    120
    180
    240
    300
    360
    420
    432

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0888 [new locus tag: SACOL_RS04560 ]
  • symbol: SACOL0888
  • description: pathogenicity island, lipoprotein
  • length: 143
  • theoretical pI: 9.27571
  • theoretical MW: 16224.4
  • GRAVY: -0.83986

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • ORF039
  • PFAM:
    no clan defined Ribosomal_L36e; Ribosomal protein L36e (PF01158; HMM-score: 16)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0005
    • Cytoplasmic Membrane Score: 0.7845
    • Cell wall & surface Score: 0.0248
    • Extracellular Score: 0.1902
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: 0
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: ILGACGS
  • SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
    • SP(Sec/SPI): 0.000446
    • TAT(Tat/SPI): 0.00005
    • LIPO(Sec/SPII): 0.99932
    • Cleavage Site: CS pos: 17-18. LGA-CG. Pr: 0.9998
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MRKLLGLALASTLILGACGSNDGDKKEESKSYTTNDIVKGFKDNKLNVINEKEMTREDFGLAPMKTDEAKMFVVQDDKNARVMKFKNSDDLKQTKKYYDELGKESAAFYSHTHSKGKFLIQMNGDIDDATFNKYKNSMDKTLK

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Lipoprotein [1] [2] [3] [4]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]