From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0890 [new locus tag: SACOL_RS04570 ]
  • pan locus tag?: SAUPAN002847000
  • symbol: SACOL0890
  • pan gene symbol?:
  • synonym:
  • product: Cro/CI family transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0890 [new locus tag: SACOL_RS04570 ]
  • symbol: SACOL0890
  • product: Cro/CI family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 907268..907600
  • length: 333
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAGAACTAATGATGAAATAATTACAATAATTAAAACATCAATGAAAGAACAAAATATG
    TCACTAAGTGAATTAGCTCGTCGTGTAGGTGTAGCAAAATCAGCAGTATCAAGATATTTA
    AATTTAACTAGAGAGTTCCCATTGAATCGCGCTGAAGATTTTGCGAAAGTACTTGGAATA
    AAAACAGAATATTTATTAGGATTTGCTGAACGCGAAGAATCTACAAAACAAGATACTATC
    GCCGCGCACTTAGATGGAGATTTTACAGAGGAAGAATTAATTGAAATTAGAAAGTATGCG
    GAGTTAGTTAGAAAAGCACATCGAAATCAGTAA
    60
    120
    180
    240
    300
    333

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0890 [new locus tag: SACOL_RS04570 ]
  • symbol: SACOL0890
  • description: Cro/CI family transcriptional regulator
  • length: 110
  • theoretical pI: 6.54552
  • theoretical MW: 12702.4
  • GRAVY: -0.553636

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 19.4)
    Signal transduction Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 19.4)
    Signal transduction Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 19.4)
    Genetic information processing Mobile and extrachromosomal element functions Prophage functions phage-associated protein, BcepMu gp16 family (TIGR04111; HMM-score: 16.3)
    and 2 more
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 13.6)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 13.4)
  • TheSEED  :
    • CI-like repressor, superantigen-encoding pathogenicity islands SaPI
    Phages, Prophages, Transposable elements, Plasmids Pathogenicity islands Staphylococcal pathogenicity islands SaPI  CI-like repressor, superantigen-encoding pathogenicity islands SaPI
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 41.8)
    and 36 more
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 27.4)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 26.7)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 25.5)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 22.6)
    HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 22.2)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 21.3)
    LacI; Bacterial regulatory proteins, lacI family (PF00356; HMM-score: 20.7)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 19.7)
    HTH_Tnp_Tc3_1; Tc3 transposase (PF11427; HMM-score: 19.3)
    MarR_2; MarR family (PF12802; HMM-score: 19.1)
    CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 18.2)
    HTH_35; Winged helix-turn-helix DNA-binding (PF13693; HMM-score: 18.1)
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 17.8)
    HTH_10; HTH DNA binding domain (PF04967; HMM-score: 16.6)
    MarR; MarR family (PF01047; HMM-score: 16.5)
    HTH_AsnC-type; AsnC-type helix-turn-helix domain (PF13404; HMM-score: 16.2)
    YdaS_antitoxin; Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT (PF15943; HMM-score: 15.8)
    no clan defined DUF5097; Domain of unknown function (DUF5097) (PF17020; HMM-score: 15.5)
    HTH (CL0123) TetR_N; Bacterial regulatory proteins, tetR family (PF00440; HMM-score: 14.7)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 14.3)
    HTH_40; Helix-turn-helix domain (PF14493; HMM-score: 14.1)
    HTH_WhiA; WhiA C-terminal HTH domain (PF02650; HMM-score: 14)
    HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 14)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 13.9)
    BetR; BetR domain (PF08667; HMM-score: 13.8)
    HTH_Tnp_1; Transposase (PF01527; HMM-score: 13.7)
    Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 13.5)
    HTH_29; Winged helix-turn helix (PF13551; HMM-score: 13.4)
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 13.3)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 13.3)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 13.2)
    HTH_11; HTH domain (PF08279; HMM-score: 13.1)
    PuR_N; Bacterial purine repressor, N-terminal (PF09182; HMM-score: 13.1)
    no clan defined DUF746; Domain of Unknown Function (DUF746) (PF05344; HMM-score: 13)
    HTH (CL0123) HTH_Tnp_ISL3; Helix-turn-helix domain of transposase family ISL3 (PF13542; HMM-score: 12.6)
    P22_Cro; DNA-binding transcriptional regulator Cro (PF14549; HMM-score: 12.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011244
    • TAT(Tat/SPI): 0.001592
    • LIPO(Sec/SPII): 0.000913
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MRTNDEIITIIKTSMKEQNMSLSELARRVGVAKSAVSRYLNLTREFPLNRAEDFAKVLGIKTEYLLGFAEREESTKQDTIAAHLDGDFTEEELIEIRKYAELVRKAHRNQ

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2]
  • quantitative data / protein copy number per cell: 235 [3]
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 6.78 h [4]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  3. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  4. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]